Identification
- Summary
Interferon beta-1b is a form of recombinant human interferon used to slow the progression of relapsing multiple sclerosis and to reduce the frequency of clinical symptoms.
- Brand Names
- Betaferon, Betaseron, Extavia
- Generic Name
- Interferon beta-1b
- DrugBank Accession Number
- DB00068
- Background
Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
- Protein Based Therapies
Interferons - Protein Structure
- Protein Chemical Formula
- C908H1408N246O253S6
- Protein Average Weight
- 20011.0 Da
- Sequences
>DB00068 sequence SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYE MLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLH LKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Download FASTA Format- Synonyms
- Interferon beta 1b (recombinant)
- Interferon beta-1b
- Interferon beta-1b,recombinant
- Interferon-beta-1b
- Recombinant interferon beta-1b
Pharmacology
- Indication
Interferon beta-1b is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Management of Relapsing multiple sclerosis (rms) •••••••••••• ••••• ••••••••• Management of Secondary progressive multiple sclerosis •••••••••••• ••••• ••••••••• - Contraindications & Blackbox Warnings
Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API- Pharmacodynamics
Interferon beta upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.
- Mechanism of action
Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Target Actions Organism AInterferon alpha/beta receptor 1 agonistHumans AInterferon alpha/beta receptor 2 agonistHumans - Absorption
Not Available
- Volume of distribution
- 0.25 to 2,88 L/kg
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
- 9.4 – 28.9 mL/min•kg-1 [patients with diseases other than MS receiving single intravenous doses up to 2.0 mg]
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs Browse all" title="About SNP Mediated Effects/ADRs" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">
- Not Available
Interactions
- Drug Interactions Learn More" title="About Drug Interactions" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbatacept The risk or severity of adverse effects can be increased when Interferon beta-1b is combined with Abatacept. Abciximab The risk or severity of bleeding can be increased when Abciximab is combined with Interferon beta-1b. Acenocoumarol The metabolism of Acenocoumarol can be decreased when combined with Interferon beta-1b. Acetaminophen The metabolism of Acetaminophen can be decreased when combined with Interferon beta-1b. Acetylsalicylic acid The risk or severity of bleeding can be increased when Acetylsalicylic acid is combined with Interferon beta-1b. - Food Interactions
- Avoid excessive or chronic alcohol consumption. Alcohol and Interferon beta-1 can both cause hepatoxicity, therefore if they are used together they may have additive hepatoxic effects.
Products
Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Betaferon Injection, powder, for solution 0.25 mg/ml Subcutaneous Bayer Ag 2016-09-08 Not applicable EU 
Betaferon Injection, powder, for solution 0.25 mg/ml Subcutaneous Bayer Ag 2016-09-08 Not applicable EU Betaferon Injection, powder, for solution 0.25 mg/ml Subcutaneous Bayer Ag 2016-09-08 Not applicable EU Betaferon Injection, powder, for solution 0.25 mg/ml Subcutaneous Bayer Ag 2016-09-08 Not applicable EU Betaferon Injection, powder, for solution 0.25 mg/ml Subcutaneous Bayer Ag 2016-09-08 Not applicable EU
Categories
- ATC Codes
- L03AB08 — Interferon beta-1b
- Drug Categories
- Adjuvants, Immunologic
- Amino Acids, Peptides, and Proteins
- Antineoplastic and Immunomodulating Agents
- Biological Factors
- Cytochrome P-450 CYP1A2 Inhibitors
- Cytochrome P-450 CYP1A2 Inhibitors (strength unknown)
- Cytochrome P-450 Enzyme Inhibitors
- Cytokines
- Immunologic Factors
- Immunosuppressive Agents
- Intercellular Signaling Peptides and Proteins
- Interferon Type I
- Interferon-beta
- Interferons
- Myelosuppressive Agents
- Peptides
- Proteins
- Recombinant Human Interferon beta
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- TTD90R31WZ
- CAS number
- 145155-23-3
References
- Synthesis Reference
Heinz-Jurgen Friesen, Sidney Pestka, "Preparation of homogeneous human fibroblast interferon." U.S. Patent US4289689, issued December, 1968.
US4289689- General References
- External Links
- UniProt
- P01574
- Genbank
- V00534
- KEGG Drug
- D00746
- KEGG Compound
- C07901
- PubChem Substance
- 46504458
- 72258
- ChEMBL
- CHEMBL1201563
- Therapeutic Targets Database
- DAP001283
- PharmGKB
- PA450039
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Interferon_beta-1b
- FDA label
- Download (1.38 MB)
Clinical Trials
- Clinical Trials Learn More" title="About Clinical Trials" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">
Phase Status Purpose Conditions Count 4 Completed Treatment Multiple Sclerosis 1 4 Completed Treatment Relapsing Multiple Sclerosis (RMS) 1 4 Completed Treatment Relapsing Remitting Multiple Sclerosis (RRMS) 5 4 Recruiting Treatment Relapsing Remitting Multiple Sclerosis (RRMS) 1 4 Terminated Prevention Relapsing Remitting Multiple Sclerosis (RRMS) 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Bayer Healthcare
- Berlex Labs
- Chiron Corp.
- InterMune Inc.
- Novartis AG
- Dosage Forms
Form Route Strength Solution Subcutaneous 0.300 mg Injection, powder, for solution Subcutaneous 0.25 mg Injection, powder, for solution Subcutaneous 0.25 MG/ML Solution Parenteral; Subcutaneous 0.25 MG/ML Injection, powder, for solution Subcutaneous 0.3 mg/vial Injection, powder, for solution Subcutaneous Injection, powder, lyophilized, for solution Subcutaneous 0.25 mg Injection, powder, lyophilized, for solution; kit Subcutaneous 0.25 mg/1mL Kit Subcutaneous 0.25 mg/1mL Powder, for solution Subcutaneous 0.3 mg / vial Injection, powder, for solution Subcutaneous 250 μg/ml Injection, powder, for solution Subcutaneous 250 MCG/ML Injection, powder, lyophilized, for solution; kit Subcutaneous 0.25 mg/1.0mL Powder Subcutaneous 250 MCG Powder Subcutaneous 8 MIU/1vial - Prices
Unit description Cost Unit Betaseron 14 0.3 mg Solution 1 Box Contains Fourteen .3 mg Vials. 3315.06USD box Betaseron 0.3 mg kit 227.69USD kit Extavia 0.3 mg kit 196.76USD kit DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Region CA1340861 No 1999-12-28 2016-12-28 Canada 
CA1339707 No 1998-03-10 2015-03-10 Canada
Properties
- State
- Liquid
- Experimental Properties
Property Value Source hydrophobicity -0.447 Not Available isoelectric point 9.02 Not Available
Targets
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock newinsights and accelerate drug research.
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Agonist
- General Function
- Type i interferon receptor activity
- Specific Function
- Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JA...
- Gene Name
- IFNAR1
- Uniprot ID
- P17181
- Uniprot Name
- Interferon alpha/beta receptor 1
- Molecular Weight
- 63524.81 Da
References
- Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [Article]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Agonist
- General Function
- Type i interferon receptor activity
- Specific Function
- Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are direc...
- Gene Name
- IFNAR2
- Uniprot ID
- P48551
- Uniprot Name
- Interferon alpha/beta receptor 2
- Molecular Weight
- 57758.24 Da
References
- Russell-Harde D, Wagner TC, Perez HD, Croze E: Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation. Biochem Biophys Res Commun. 1999 Feb 16;255(2):539-44. [Article]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Enzymes
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- Actions
- Inhibitor
- General Function
- Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
- Specific Function
- Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
- Gene Name
- CYP1A2
- Uniprot ID
- P05177
- Uniprot Name
- Cytochrome P450 1A2
- Molecular Weight
- 58293.76 Da
References
- Delaporte E, Renton KW: Cytochrome P4501A1 and cytochrome P4501A2 are downregulated at both transcriptional and post-transcriptional levels by conditions resulting in interferon-alpha/beta induction. Life Sci. 1997;60(10):787-96. doi: 10.1016/s0024-3205(97)00006-4. [Article]
Drug created at June 13, 2005 13:24 / Updated at January 02, 2024 23:41