Trastuzumab

Identification

Summary

Trastuzumab is a monoclonal anti-human epidermal growth factor receptor 2 protein antibody used to treat HER2-positive breast, gastroesophageal, and gastric cancers.

Brand Names

Herceptin, Herceptin Hylecta, Herzuma, Kanjinti, Ontruzant, Perjeta-Herceptin, Phesgo, Trazimera

Generic Name

Trastuzumab

DrugBank Accession Number

DB00072

Background

Produced in CHO cell cultures, trastuzumab is a recombinant IgG1 kappa, humanized monoclonal antibody ⁶ that selectively binds with high affinity in a cell-based assay (Kd = 5 nM) to the extracellular domain of the human epidermal growth factor receptor protein (HER2).¹² It is used as a treatment of human epidermal growth factor receptor (HER)-2+ metastatic breast cancer, where there is a proven amplification of the HER-2 oncogene or over-expression of the HER-2 protein in tumours. It is suggested that the overexpression or gene amplification of HER2 has been found in about 20–30% of breast cancers and elevated activation of HER2 triggers multiple downstream pathways leading to abnormal proliferation of cancer cells ⁴. Trastuzumab binds to HER2 and suppresses cancer cell growth, proliferation, and survival directly and indirectly ⁴.

In December 2017, FDA approved OGIVRI (trastuzumab-dkst) as a biosimilar to Herceptin (trastuzumab) for the treatment of patients with breast or metastatic stomach cancer (gastric or gastroesophageal junction adenocarcinoma) whose tumors overexpress the HER2 gene (HER2+). It displays biosimilar properties as Herceptin according to clinical data. While Ogivri is the first biosimilar approved in the U.S. for the treatment of breast cancer or stomach cancer, it is the second biosimilar approved in the U.S. for the treatment of cancer. Herzuma (trastuzumab-pkrb) is a biosimilar drug approved in December 2018 for the treatment of HER2-overexpressing breast cancer. KANJINTI (trastuzumab-anns) is another biosimilar approved by the FDA in June 2019.¹⁶ ONTRUZANT, another biosimilar of Herceptin, was approved by Health Canada in February 2022.^22,23 In November 2023, trastuzumab was also approved by the EMA under the brand name Herwenda.²⁵

Type

Biotech

Groups

Approved, Investigational

Biologic Classification

Protein Based Therapies
Monoclonal antibody (mAb)

Protein Structure

Protein Chemical Formula: C₆₄₇₀H₁₀₀₁₂N₁₇₂₆O₂₀₁₃S₄₂
Protein Average Weight: 145531.5 Da

Sequences

>Anti-HER2 Light chain (1 and 2)
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

>Anti-HER2 Heavy chain (1 and 2)
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Download FASTA Format

Synonyms

RHUMAB HER2
Trastuzumab
trastuzumab-anns
trastuzumab-dkst
trastuzumab-dttb
trastuzumab-pkrb
trastuzumab-qyyp

External IDs

4D5V8
ABP 980
ABP-980
DMB-3111
EG-12014
EG12014
R-597
SB-3
SYD-977
SYD977

Poor quality drug data slowing you down?

Unlock 38% more drug discovery time and eliminate decision-making doubts with this one-stop guide to quality drug data.

Download eBook

Poor quality drug data slowing you down?

Download eBook

Pharmacology

Indication

For the adjuvant treatment of HER2-overexpressing breast cancer, trastuzumab is indicated in several clinical settings: as part of a treatment regimen consisting of doxorubicin, cyclophosphamide, and either paclitaxel or docetaxel; as part of a treatment regimen with docetaxel and carboplatin; or as monotherapy following multi-modality anthracycline-based therapy.¹²

Trastuzumab is indicated as a first-line treatment, in combination with paclitaxel, for metastatic HER2-overexpressing breast cancer, and as monotherapy in patients who have previously received one or more chemotherapy regimens in the metastatic setting.¹² In Europe, trastuzumab can also be used in combination with paclitaxel or docetaxel for the treatment of metastatic HER2-positive breast cancer in adult patients and with an aromatase inhibitor in postmenopausal patients.²⁴

For HER2-positive early breast cancer, the EMA approved trastuzumab as monotherapy following surgery, chemotherapy (neoadjuvant or adjuvant), and radiation or following adjuvant chemotherapy with doxorubicin and cyclophosphamide in combination with paclitaxel or docetaxel. It can also be used in combination with adjuvant chemotherapy consisting of docetaxel and carboplatin or with neoadjuvant chemotherapy followed by adjuvant trastuzumab therapy for locally advanced (including inflammatory) disease or tumors > 2 cm in diameter.²⁴

Trastuzumab is also indicated, in combination with cisplatin and capecitabine or 5-fluorouracil, for the treatment of patients with HER2-overexpressing metastatic gastric or gastroesophageal junction adenocarcinoma who have not received prior treatment for metastatic disease by the FDA and EMA.¹²

Trastuzumab is indicated for subcutaneous administration - in combination with either hyaluronidase¹⁵ or both hyaluronidase and pertuzumab²⁰ - for the treatment of adults with HER2-positive breast cancers.

Reduce drug development failure rates

Build, train, & validate machine-learning models
with evidence-based and structured datasets.

See how

Build, train, & validate predictive machine-learning models with structured datasets.

See how

Associated Conditions

Indication Type	Indication	Combined Product Details	Approval Level	Patient Characteristics	Dose Form
Used in combination to treat	Breast cancer	Combination Product in combination with: Hyaluronidase (human recombinant) (DB06205)	••••••••••••		•••••••••
Treatment of	Breast cancer		••••••••••••		•••••••••
Used in combination to treat	Breast cancer	Regimen in combination with: Carboplatin (DB00958), Docetaxel (DB01248)	••••••••••••		•••••••••• ••••••• ••• ••••••••
Used in combination to treat	Breast cancer	Regimen in combination with: Docetaxel (DB01248), Paclitaxel (DB01229)	••••••••••••	•••• •••••••••••• •••• ••••••••••• ••• ••••••••••••••••	•••••••••• ••••••• ••• ••••••••
Treatment of	Breast cancer		••••••••••••	•••••••• •••••••••••••••••	•••••••••• ••••••• ••• ••••••••

Contraindications & Blackbox Warnings

Prevent Adverse Drug Events Today

Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.

Learn more

Avoid life-threatening adverse drug events with our Clinical API

Learn more

Pharmacodynamics

Trastuzumab exerts an antitumour activity and is used in the treatment of HER2-positive breast cancer. HER2 protein overexpression is observed in 20%-30% of primary breast cancers ⁷ thus HER2 presents as a useful therapeutic target for the treatment of breast cancers. Trastuzumab has been shown, in both in vitro assays and in animals, to inhibit the proliferation of human tumour cells that overexpress HER2. It works as a mediator of antibody-dependent cellular cytotoxicity, where it binds as an antibody to cells over-expressing HER2, leading to preferential cell death. Trastuzumab was also shown to inhibit angiogenesis of tumor cells in vivo ⁴. Higher doses and longer dosing intervals show no significant benefit over standard dose schedules ⁶. In patients with HER2 positive solid tumours, trastuzumab did not exert any clinically significant QTc interval duration.¹²

Mechanism of action

Trastuzumab is a recombinant humanized IgG1 monoclonal antibody against the HER-2 receptor, a member of the epidermal growth factor receptors which is a photo-oncogene. Over-expressed in breast tumour cells, HER-2 overamplifies the signal provided by other receptors of the HER family by forming heterodimers ⁴. The HER-2 receptor is a transmembrane tyrosine kinase receptor that consists of an extracellular ligand-binding domain, a transmembrane region, and an intracellular or cytoplasmic tyrosine kinase domain. It is activated by the formation of homodimers or heterodimers with other EGFR proteins, leading to dimerization and autophosphorylation and/or transphosphorylation of specific tyrosine residues in EGFR intracellular domains ⁴. Further downstream molecular signaling cascades are activated, such as the Ras/Raf/mitogen-activated protein kinase (MAPK), the phosphoinositide 3-kinase/Akt, and the phospholipase Cγ (PLCγ)/protein kinase C (PKC) pathways that promote cell growth and survival and cell cycle progression ⁴. Due to upregulation of HER-2 in tumour cells, hyperactivation of these signaling pathways and abnormal cell proliferation is observed. Trastuzumab binds to the extracellular ligand-binding domain and blocks the cleavage of the extracellular domain of HER-2 to induce its antibody-induced receptor downmodulation ⁴, and subsequently inhibits HER-2-mediated intracellular signaling cascades. Inhibition of MAPK and PI3K/Akt pathways lead to an increase in cell cycle arrest, and the suppression of cell growth and proliferation ⁴. Trastuzumab also mediates the activation of antibody-dependent cell-mediated cytotoxicity (ADCC) ⁶ by attracting the immune cells, such as natural killer (NK) cells, to tumor sites that overexpress HER-2 ⁴. While the drug alone has a minimal potential to induce complement-dependent cytotoxicity (CDC),⁸ one study demonstrated increased therapeutic effectiveness and a synergistic effect on uterine serous carcinoma cells in vitro when used in combination with pertuzumab, which also has minor effects on CDC alone. This study showed that only the combination of both cell-bound antibodies would be sufficient to bind and activate the complement component 1q (C1q) required to initiate the complement cascade reaction.⁹

Intrinsic trastuzumab resistance has been noted for some patients with HER-2 positive breast cancer. Mechanisms involving trastuzumab resistance include deficiency of phosphatase and tensin homologue and activation of phosphoinositide 3-kinase, and the overexpression of other surface receptors, such as insulin-like growth factor ⁶.

Target	Actions	Organism
AReceptor tyrosine-protein kinase erbB-2	binder antibody	Humans

Absorption

Peak and trough plasma concentrations at steady state (between weeks 16 and 32) were approximately 123 and 79 mcg/mL, respectively. At the highest weekly dose studied (500 mg), mean peak serum concentration was 377 mcg/mL.¹²

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

After it binds to HER2, trastuzumab is metabolized intracellularly into smaller peptides and amino acids.⁶

Route of elimination

Following metabolism, the complex elimination of trastuzumab in humans is mediated by epithelial cells in a dose-dependent (nonlinear) fashion.⁶ The renal excretion of trastuzumab is very low.⁶

Half-life

The terminal half-life is approximately 28 days,⁶ but may decrease with lower doses - at the 10mg and 500mg doses, half-lives averaged approximately 1.7 and 12 days, respectively.¹¹

Clearance

The predicted steady-state clearance of trastuzumab is 0.173 - 0.337 L/day, dependent primarily on the dosing regimen.¹² The clearance rate for subcutaneously administered trastuzumab, formulated with hyaluronidase for improved subcutaneous absorption, is 0.11 L/day.¹⁵

Adverse Effects

Improve decision support & research outcomes

With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!

See the data

Improve decision support & research outcomes with our structured adverse effects data.

See a data sample

Toxicity

There is no experience with overdosage of trastuzumab in clinical trials - single doses >8 mg/kg have not been tested in humans.¹² Trastuzumab can contribute to the development of ventricular dysfunction and congestive heart failure, particularly when used in combination (or temporally adjacent) to other cardiotoxic chemotherapies such as anthracyclines.¹²

Pathways

Pathway	Category
Trastuzumab Action Pathway	Drug action

Pharmacogenomic Effects/ADRs Browse all" title="About SNP Mediated Effects/ADRs" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">

Interacting Gene/Enzyme	Allele name	Genotype(s)	Defining Change(s)	Type(s)	Description	Details
Receptor tyrosine-protein kinase erbB-2	---	(A;G)	G Allele, heterozygote	ADR Directly Studied	Patients with this genotype have increased risk of cardiotoxicity with trastuzumab.	Details

Interactions

Drug Interactions Learn More" title="About Drug Interactions" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Drug	Interaction
Integrate drug-drug interactions in your software
Abatacept	The risk or severity of neutropenia can be increased when Trastuzumab is combined with Abatacept.
Abciximab	The risk or severity of adverse effects can be increased when Abciximab is combined with Trastuzumab.
Acetyldigitoxin	Acetyldigitoxin may decrease the cardiotoxic activities of Trastuzumab.
Adalimumab	The risk or severity of neutropenia can be increased when Trastuzumab is combined with Adalimumab.
Adenovirus type 7 vaccine live	The risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Trastuzumab.

Food Interactions

No interactions found.

Products

Drug product information from 10+ global regions

Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.

Access now

Access drug product information from over 10 global regions.

Access now

International/Other Brands

Herclon (Roche)

Brand Name Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Herceptin	Powder, for solution	440 mg / vial	Intravenous	Hoffmann La Roche	1999-08-23	Not applicable
Herceptin	Injection, powder, for solution	150 mg	Intravenous	Roche Registration Gmb H	2016-09-08	Not applicable
Herceptin		420 mg/20mL	Intravenous	Genentech, Inc.	1998-09-25	Not applicable
Herceptin	Injection	150 mg/7.4mL	Intravenous	Genentech, Inc.	1998-09-25	Not applicable
Herceptin	Injection, solution	600 mg	Subcutaneous	Roche Registration Gmb H	2016-09-08	Not applicable

Mixture Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
Herceptin Hylecta	Trastuzumab (600 mg/5mL) + Hyaluronidase (human recombinant) (10000 U/5mL)	Injection, solution	Subcutaneous	Genentech, Inc.	2019-02-28	Not applicable
Ogivri	Trastuzumab (440 mg / vial) + Water (20 mL / vial)	Powder, for solution	Intravenous	Biosimilar Collaborations Ireland Limited	2019-06-06	Not applicable
Perjeta-herceptin	Trastuzumab (440 mg / vial) + Pertuzumab (420 mg / 14 mL)	Kit; Powder, for solution; Solution	Intravenous	Hoffmann La Roche	2013-05-09	Not applicable
Phesgo	Trastuzumab (600 mg) + Pertuzumab (1200 mg)	Injection, solution	Subcutaneous	Roche Registration Gmb H	2021-01-28	Not applicable
Phesgo	Trastuzumab (600 mg/10mL) + Hyaluronidase (human recombinant) (20000 U/10mL) + Pertuzumab (600 mg/10mL)	Injection, solution	Subcutaneous	Genentech, Inc.	2020-06-29	Not applicable

Chemical Identifiers

UNII: P188ANX8CK
CAS number: 180288-69-1

References

General References

Bange J, Zwick E, Ullrich A: Molecular targets for breast cancer therapy and prevention. Nat Med. 2001 May;7(5):548-52. [Article]
Menard S, Pupa SM, Campiglio M, Tagliabue E: Biologic and therapeutic role of HER2 in cancer. Oncogene. 2003 Sep 29;22(42):6570-8. [Article]
Kute T, Lack CM, Willingham M, Bishwokama B, Williams H, Barrett K, Mitchell T, Vaughn JP: Development of Herceptin resistance in breast cancer cells. Cytometry A. 2004 Feb;57(2):86-93. [Article]
Albanell J, Codony J, Rovira A, Mellado B, Gascon P: Mechanism of action of anti-HER2 monoclonal antibodies: scientific update on trastuzumab and 2C4. Adv Exp Med Biol. 2003;532:253-68. [Article]
Tan AR, Swain SM: Ongoing adjuvant trials with trastuzumab in breast cancer. Semin Oncol. 2003 Oct;30(5 Suppl 16):54-64. [Article]
Boekhout AH, Beijnen JH, Schellens JH: Trastuzumab. Oncologist. 2011;16(6):800-10. doi: 10.1634/theoncologist.2010-0035. Epub 2011 May 31. [Article]
Vu T, Claret FX: Trastuzumab: updated mechanisms of action and resistance in breast cancer. Front Oncol. 2012 Jun 18;2:62. doi: 10.3389/fonc.2012.00062. eCollection 2012. [Article]
Rogers LM, Veeramani S, Weiner GJ: Complement in monoclonal antibody therapy of cancer. Immunol Res. 2014 Aug;59(1-3):203-10. doi: 10.1007/s12026-014-8542-z. [Article]
Mamidi S, Cinci M, Hasmann M, Fehring V, Kirschfink M: Lipoplex mediated silencing of membrane regulators (CD46, CD55 and CD59) enhances complement-dependent anti-tumor activity of trastuzumab and pertuzumab. Mol Oncol. 2013 Jun;7(3):580-94. doi: 10.1016/j.molonc.2013.02.011. Epub 2013 Feb 20. [Article]
US Patent US6870034B2 (includes Trastuzumab heavy chain sequence) [Link]
Health Canada Product Monograph: Ogivri (trastuzumab) powder for intravenous infusion [Link]
FDA Approved Drug Products: Herceptin (trastuzumab) for intravenous injection [Link]
FDA Approved Drug Products: Ogivri (trastuzumab-dkst) for intravenous infusion [Link]
FDA Approved Drug Products: Herzuma (trastuzumab-pkrb) for intravenous infusion [Link]
FDA Approved Drug Products: Herceptin Hylecta (trastuzumab and hyaluronidase-oysk) for subcutaneous injection [Link]
FDA Approved Drug Products: Kanjinti (trastuzumab-anns) for intravenous infusion [Link]
FDA Approved Drug Products: Ontruzant (trastuzumab-dttb) for intravenous infusion [Link]
FDA Approved Drug Products: Trazimera (trastuzumab-qyyp) for intravenous infusion [Link]
Genentech: Herceptin(R) MSDS [Link]
FDA News Release: FDA Approves Breast Cancer Treatment That Can Be Administered At Home By Health Care Professional [Link]
FDA Approved Drug Products: Phesgo (pertuzumab/trastuzumab/hyaluronidase-zzxf) for subcutaneous injection [Link]
Health Canada Product Monograph: ONTRUZANT (trastuzumab) intravenous infusion [Link]
GlobeNewsWire: Samsung Bioepis Announces Health Canada Approval of 150mg Single-use Vial and 440mg Multi-dose Vial of ONTRUZANT® (SB3), Trastuzumab Biosimilar for the Treatment of Adults with Early Breast Cancer, Metastatic Breast Cancer, and Metastatic Gastric Cancer [Link]
EMA Product Information: HERWENDA (trastuzumab) Powder for concentrate for solution for infusion (December 2023) [Link]
An overview of Herwenda and why it is authorised in the EU [Link]
Trastuzumab: Antineoplastic agent; a recombinant DNA- derived humanized anti-HER2 monoclonal antibody (complete heavy chain sequence) [File]

External Links

UniProt: P01857
Genbank: J00228
KEGG Drug: D03257
PubChem Substance: 46507516
RxNav: 224905
ChEMBL: CHEMBL1201585
Therapeutic Targets Database: DAP000391
PharmGKB: PA451743
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Trastuzumab

MSDS

Download (320 KB)

Clinical Trials

Clinical Trials Learn More" title="About Clinical Trials" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">

Phase	Status	Purpose	Conditions	Count
4	Completed	Diagnostic	Breast Cancer	1
4	Completed	Treatment	Breast Cancer	4
4	Not Yet Recruiting	Treatment	Infusion related reaction / Oncology	1
4	Recruiting	Diagnostic	Anatomic Stage IV Breast Cancer AJCC v8 / Brain Metastases / Metastatic Breast Carcinoma	1
4	Recruiting	Treatment	Advanced Breast Cancer / HER2/Neu-positive Breast Cancer	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

DSM Corp.
F Hoffmann-La Roche Ltd.
Genentech Inc.

Dosage Forms

Form	Route	Strength
Injection	Parenteral	150 mg
Injection	Intravenous	150 mg/7.4mL
Injection	Parenteral	600 MG/5ML
Injection, powder, for solution	Intravenous
Injection, powder, lyophilized, for solution	Intravenous	150 mg/7.4mL
Injection, solution	Parenteral; Subcutaneous	600 MG/5ML
Injection, solution	Parenteral; Subcutaneous	600 MG
Powder, for solution	Intravenous	440 mg / vial
Injection, solution		600 mg/5ml
Injection, powder, lyophilized, for solution	Intravenous	44000000 mg
Injection, solution	Subcutaneous	600 mg/5ml
Injection, solution	Subcutaneous
Injection, solution	Subcutaneous
Injection, powder, for solution	Intravenous	440 mg
Solution	Subcutaneous	600 mg / 5 mL
Solution	Subcutaneous	600.00 mg
Injection, solution	Subcutaneous	600 mg
Solution	Subcutaneous	600 mg
Powder	Intravenous	150 mg
Injection, powder, for solution		440 mg
Injection, powder, for solution	Intravenous	420 mg
Injection, powder, for solution	Intravenous; Parenteral	150 MG
Kit; powder, for solution	Intravenous	440 mg / vial
Solution	Intravenous	150.00 mg
Injection, powder, for solution	Intravenous	150 mg/1vial
Injection, solution, concentrate	Intravenous	150 mg
Injection, powder, lyophilized, for solution	Intravenous	150 mg
Injection, powder, for solution
Injection, powder, for solution		160 mg/1vial
Injection, powder, lyophilized, for solution	Intravenous	150 mg/7.15mL
Injection, powder, lyophilized, for solution	Intravenous	420 mg/20mL
Kit; powder, for solution	Intravenous	420 mg / vial
Injection, powder, for solution		150 mg
Injection, powder, for solution	Intravenous	150 mg
Powder, for solution	Intravenous
Powder, for solution	Intravenous	150 mg / vial
Injection, powder, for solution	Intravenous; Parenteral	420 MG
Injection, powder, lyophilized, for solution	Intravenous	150 mg/1
Kit	Intravenous	420 mg/1
Powder, for solution	Intravenous	150 mg
Powder, for solution	Intravenous	420 mg
Kit; powder, for solution; solution	Intravenous
Solution	Subcutaneous
Solution	Subcutaneous	6000000 mg
Injection, powder, lyophilized, for solution; kit	Intravenous	420 mg/20mL
Injection, solution, concentrate	Intravenous	150 mg/1vial
Injection, solution, concentrate	Intravenous	440 mg/1vial
Injection, powder, lyophilized, for solution	Intravenous	440 mg
Injection, powder, lyophilized, for solution	Intravenous
Injection, powder, for solution	Intravenous	60 mg
Injection, powder, for solution	Intravenous; Parenteral	60 mg
Solution	Intravenous
Injection, powder, for solution	Intravenous	440 mg/1vial
Powder	Intravenous	440 mg/1bottle
Powder	Intravenous	150 mg/1vial
Powder	Intravenous	150 mg/1bottle
Injection, powder, for solution		100 mg/1vial

Prices

Unit description	Cost	Unit
Herceptin 440 mg Solution Vial	3581.2USD	vial
Herceptin 440 mg vial	3443.46USD	vial

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)	Region
CA2103059	No	2005-03-22	2012-06-15

Properties

State

Solid

Experimental Properties

Property	Value	Source
melting point (°C)	61 °C (FAB fragment), 71 °C (whole mAb)	Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)

Targets

Build, predict & validate machine-learning models

Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.

Learn more

Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.

Learn more

Details1. Receptor tyrosine-protein kinase erbB-2

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Binder
Antibody

General Function: Transmembrane signaling receptor activity
Specific Function: Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, alt...
Gene Name: ERBB2
Uniprot ID: P04626
Uniprot Name: Receptor tyrosine-protein kinase erbB-2
Molecular Weight: 137909.27 Da

References

Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Leveque D, Gigou L, Bergerat JP: Clinical pharmacology of trastuzumab. Curr Clin Pharmacol. 2008 Jan;3(1):51-5. [Article]
Lin A, Rugo HS: The role of trastuzumab in early stage breast cancer: current data and treatment recommendations. Curr Treat Options Oncol. 2007 Feb;8(1):47-60. [Article]
Treish I, Schwartz R, Lindley C: Pharmacology and therapeutic use of trastuzumab in breast cancer. Am J Health Syst Pharm. 2000 Nov 15;57(22):2063-76; quiz 2077-9. [Article]

Drug created at June 13, 2005 13:24 / Updated at December 22, 2023 19:51

Trastuzumab

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Pharmacoeconomics

Properties

Targets

References