Choriogonadotropin alfa

Identification

Summary

Choriogonadotropin alfa is a recombinant form of human chorionic gonadotropin used to treat female infertility by inducing ovulation.

Brand Names

Ovidrel, Ovitrelle, Pregnyl

Generic Name

Choriogonadotropin alfa

DrugBank Accession Number

DB00097

Background

Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.

Type

Biotech

Groups

Approved

Biologic Classification

Protein Based Therapies
Hormones

Protein Structure

Protein Chemical Formula: C₁₁₀₅H₁₇₇₀N₃₁₈O₃₃₆S₂₆
Protein Average Weight: 25719.7 Da

Sequences

>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

>Beta chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ

Download FASTA Format

Synonyms

Choriogonadotropin alfa
Choriogonadotropin alpha
Chorionic gonadotropin (recombinant)

Poor quality drug data slowing you down?

Unlock 38% more drug discovery time and eliminate decision-making doubts with this one-stop guide to quality drug data.

Download eBook

Poor quality drug data slowing you down?

Download eBook

Pharmacology

Indication

For the treatment of female infertility

Reduce drug development failure rates

Build, train, & validate machine-learning models
with evidence-based and structured datasets.

See how

Build, train, & validate predictive machine-learning models with structured datasets.

See how

Associated Conditions

Indication Type	Indication	Combined Product Details	Approval Level	Age Group	Patient Characteristics	Dose Form
Management of	Secondary hypogonadotrophic hypogonadism		••••••••••••			•••••••••• •••

Associated Therapies

Contraindications & Blackbox Warnings

Prevent Adverse Drug Events Today

Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.

Learn more

Avoid life-threatening adverse drug events with our Clinical API

Learn more

Pharmacodynamics

Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.

Mechanism of action

Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.

Target	Actions	Organism
ALutropin-choriogonadotropic hormone receptor	Not Available	Humans
AFollicle-stimulating hormone receptor	binder	Humans

Absorption

The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.

Volume of distribution

5.9 ± 1.0 L

Protein binding

Not Available

Metabolism

Not Available

Route of elimination

One-tenth of the dose is excreted in the urine.

Half-life

The mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours).

Clearance

0.29 +/- 0.04 L/h [healthy down-regulated females]

Adverse Effects

Improve decision support & research outcomes

With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!

See the data

Improve decision support & research outcomes with our structured adverse effects data.

See a data sample

Toxicity

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs Browse all" title="About SNP Mediated Effects/ADRs" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">

Not Available

Interactions

Drug Interactions Learn More" title="About Drug Interactions" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">: This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions: No interactions found.

Products

Drug product information from 10+ global regions

Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.

Access now

Access drug product information from over 10 global regions.

Access now

International/Other Brands

Profasi (Serono S.A.)

Brand Name Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Chorionic Gonadotropin	Kit	10000 [USP'U]/10mL	Intramuscular	Physicians Total Care, Inc.	2007-07-13	2008-06-30
Chorionic Gonadotropin	Kit	10000 [USP'U]/10mL	Intramuscular	Fresenius Kabi USA, LLC	2011-04-21	Not applicable
Chorionic Gonadotropin	Kit	10000 [USP'U]/10mL	Intramuscular	APP Pharmaceuticals, LLC	2011-04-21	2011-04-20
Ovidrel	Solution	250 mcg / 0.5 mL	Subcutaneous	Emd Serono, A Division Of Emd Inc., Canada	2013-05-28	Not applicable
Ovidrel	Solution	250 mcg / 0.5 mL	Subcutaneous	Emd Serono, A Division Of Emd Inc., Canada	2004-12-20	Not applicable

Chemical Identifiers

UNII: 6413W06WR3
CAS number: 177073-44-8

References

General References

Kayisli UA, Selam B, Guzeloglu-Kayisli O, Demir R, Arici A: Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system. J Immunol. 2003 Sep 1;171(5):2305-13. [Article]
Askling J, Erlandsson G, Kaijser M, Akre O, Ekbom A: Sickness in pregnancy and sex of child. Lancet. 1999 Dec 11;354(9195):2053. [Article]

External Links

UniProt: P01233
Genbank: J00117
PubChem Substance: 46506863
RxNav: 283550
ChEMBL: CHEMBL1201464
Therapeutic Targets Database: DAP001030
PharmGKB: PA164783947
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Human_chorionic_gonadotropin

FDA label

Download (97.1 KB)

Clinical Trials

Clinical Trials Learn More" title="About Clinical Trials" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">

Phase	Status	Purpose	Conditions	Count
4	Completed	Prevention	BRCA 1 Gene Mutation / BRCA 2 Gene Mutation / HCG	1
4	Completed	Treatment	Female Infertility / In Vitro Fertilization (IVF) / Ovarian Reserve	1
4	Completed	Treatment	Infertile Women Undergoing Assisted Reproductive Technology (ART)	1
4	Completed	Treatment	Infertility	2
4	Completed	Treatment	Infertility / Progesterone Levels	1

Pharmacoeconomics

Manufacturers

Emd serono inc
Ferring pharmaceuticals inc
App pharmaceuticals llc
Bel mar laboratories inc
Bristol myers squibb
Organon usa inc

Packagers

EMD Canada Inc.
Ferring Pharmaceuticals Inc.
Merck KGaA
Organon Pharmaceuticals

Dosage Forms

Form	Route	Strength
Injection, solution	Subcutaneous	250 ug/0.5mL
Solution	Subcutaneous	250 mcg / 0.5 mL
Solution	Subcutaneous	250.00 mcg
Injection, solution	Subcutaneous
Injection, solution	Subcutaneous	250 mcg
Injection, powder, for solution	Subcutaneous	250 MCG
Injection, solution	Subcutaneous	250 micrograms
Injection, solution	Subcutaneous	250 micrograms/0.5ml
Injection, solution	Subcutaneous	250 MCG/0.5ML
Injection, powder, lyophilized, for solution; kit	Intramuscular	10000 [USP'U]/10mL
Kit	Intramuscular	10000 [USP'U]/10mL

Prices

Unit description	Cost	Unit
Novarel 10000 unit/10ml Solution 1 Vial = 10ml	118.55USD	vial
Novarel 10000 unit vial	113.99USD	vial
Ovidrel 250 mcg/0.5ml Injectable 0.5ml Syringe	93.22USD	syringe
Pregnyl 10000 unit Solution	60.7USD	vial
Pregnyl 10000 unit vial	57.23USD	vial

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)	Region
US5767251	No	1998-06-16	2015-06-16
US6706681	No	2004-03-16	2021-03-16

Properties

State

Solid

Experimental Properties

Property	Value	Source
melting point (°C)	55 °C	Forastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity	-0.258	Not Available
isoelectric point	8.61	Not Available

Targets

Build, predict & validate machine-learning models

Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.

Learn more

Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.

Learn more

Details1. Lutropin-choriogonadotropic hormone receptor

Kind: Protein
Organism: Humans
Pharmacological action: Yes

General Function: Luteinizing hormone receptor activity
Specific Function: Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name: LHCGR
Uniprot ID: P22888
Uniprot Name: Lutropin-choriogonadotropic hormone receptor
Molecular Weight: 78642.01 Da

References

Bodek G, Vierre S, Rivero-Muller A, Huhtaniemi I, Ziecik AJ, Rahman NA: A novel targeted therapy of Leydig and granulosa cell tumors through the luteinizing hormone receptor using a hecate-chorionic gonadotropin beta conjugate in transgenic mice. Neoplasia. 2005 May;7(5):497-508. [Article]
Gromoll J, Wistuba J, Terwort N, Godmann M, Muller T, Simoni M: A new subclass of the luteinizing hormone/chorionic gonadotropin receptor lacking exon 10 messenger RNA in the New World monkey (Platyrrhini) lineage. Biol Reprod. 2003 Jul;69(1):75-80. Epub 2003 Feb 19. [Article]
Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [Article]

Details2. Follicle-stimulating hormone receptor

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Binder

General Function: G-protein coupled peptide receptor activity
Specific Function: Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and S...
Gene Name: FSHR
Uniprot ID: P23945
Uniprot Name: Follicle-stimulating hormone receptor
Molecular Weight: 78264.07 Da

References

Jameson JL: Inherited disorders of the gonadotropin hormones. Mol Cell Endocrinol. 1996 Dec 20;125(1-2):143-9. [Article]
Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [Article]
Tao YX, Segaloff DL: Follicle stimulating hormone receptor mutations and reproductive disorders. Prog Mol Biol Transl Sci. 2009;89:115-31. doi: 10.1016/S1877-1173(09)89005-4. Epub 2009 Oct 7. [Article]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]

Drug created at June 13, 2005 13:24 / Updated at February 20, 2024 23:55

Choriogonadotropin alfa

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Pharmacoeconomics

Properties

Targets

References

References