Coagulation Factor IX (Recombinant)

Identification

Summary

Coagulation Factor IX (Recombinant) is a form of recombinant human coagulation Factor IX used to treat hemophilia B.

Brand Names

Benefix, Idelvion, Ixinity, Rixubis

Generic Name

Coagulation Factor IX (Recombinant)

DrugBank Accession Number

DB00100

Background

Recombinant Coagulation Factor IX is a purified Factor IX glycoprotein produced by recombinant DNA technology. It has a primary amino acid sequence that is identical to the Ala148 allelic form of human factor IX, and has structural and functional characteristics similar to those of endogenous factor IX. It is not derived from human blood (unlike human Factor IX complex), and is instead produced by a genetically engineered Chinese hamster ovary (CHO) cell line that secretes recombinant Factor IX into cell medium that is then processed and purified for use as a pharmaceutical agent.

Recombinant Factor IX is indicated for the control and prevention of bleeding episodes in adult and pediatric patients with congenital factor IX deficiency (Hemophilia B).

Type

Biotech

Groups

Approved, Investigational

Biologic Classification

Protein Based Therapies
Blood factors

Protein Structure

Protein Chemical Formula: C₂₀₄₁H₃₁₃₆N₅₅₈O₆₄₁S₂₅
Protein Average Weight: 46548.2 Da

Sequences

>DB00100 sequence
YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG
SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAEN
QKSCEPAVPFPCGRVSVSQTSKLTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTR
VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEE
TEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFL
KFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDS
CQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT

Download FASTA Format

Synonyms

Coagulation factor IX (recombinant)
Coagulation factor IX recombinant human
Coagulation factor IX, recombinant
Factor IX (Recombinant)
nonacog alfa
nonacog gamma
Recombinant factor IX

Poor quality drug data slowing you down?

Unlock 38% more drug discovery time and eliminate decision-making doubts with this one-stop guide to quality drug data.

Download eBook

Poor quality drug data slowing you down?

Download eBook

Pharmacology

Indication

For treatment of hemophilia (Christmas disease).

Reduce drug development failure rates

Build, train, & validate machine-learning models
with evidence-based and structured datasets.

See how

Build, train, & validate predictive machine-learning models with structured datasets.

See how

Associated Conditions

Indication Type	Indication	Approval Level	Age Group	Dose Form
Prophylaxis of	Bleeding	••••••••••••	••••••••••• •••••
Management of	Bleeding	••••••••••••	••••••••••• •••••• •••••••••	•••••••••• •••
Management of	Hemophilia b	••••••••••••	•••••	•••••••••• •••
Management of	Perioperative bleeding caused by hemophilia b	••••••••••••	••••••••••• •••••• •••••••••	•••••••••• •••

Contraindications & Blackbox Warnings

Prevent Adverse Drug Events Today

Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.

Learn more

Avoid life-threatening adverse drug events with our Clinical API

Learn more

Pharmacodynamics

Binds vitamin K and factor VIIIa. Cleaves the Arg-Ile bond in factor X to form active factor Xa. Plays a key role in blood coagulation and clotting. Injections of factor IX are used to treat hemophilia B, which is sometimes called Christmas disease. AlphaNine is injected to increase plasma levels of Factor IX and can temporarily correct this coagulation defect. The activated partial thromboplastin time (aPTT) is prolonged in people with hemophilia B. Treatment with factor IX concentrate may normalize the aPTT by temporarily replacing the factor IX. The administration of BeneFIX increases plasma levels of factor IX, and can temporarily correct the coagulation defect in these patients.

Mechanism of action

Coagulation Factor IX is an important protein in the process of hemostasis and normal blood clotting as it plays a key role within the coagulation cascade. It is located within the blood plasma as a zymogen, an antecedent to enzymatic function, in its inactivated state. Factor IX is dependent on the presence of Vitamin K, and is activated to a serine protease by the function of Coagulation Factor XIa. Factor XIa cleaves the peptide bond associated with protein activation in Factor IX, leaving Factor IX with two exposed chains, a light chain and a heavy chain. These two chains are held together by several disulfide bonds that reinforce the structure of Factor IX's activated form. After being activated, Factor IX forms a complex with calcium ions, membrane phospholipids and Coagulation Factor VIII to activate Coagulation Factor X. The activation of Factor X then performs a similarly integral step in the blood coagulation cascade. The ultimate result of phenotypically normal coagulation factors is the creation of platelets for normal blood clotting.

Target	Actions	Organism
ACoagulation factor X	activator	Humans
ACoagulation factor XI	ligand	Humans
ACoagulation factor VII	ligand	Humans
ACoagulation factor VIII	cofactor	Humans
UProthrombin	Not Available	Humans
UProlow-density lipoprotein receptor-related protein 1	Not Available	Humans
UVitamin K-dependent gamma-carboxylase	Not Available	Humans

Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

Not Available

Route of elimination

Not Available

Half-life

18.8 ± 5.4 hours

Clearance

8.62 ± 1.7

Adverse Effects

Improve decision support & research outcomes

With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!

See the data

Improve decision support & research outcomes with our structured adverse effects data.

See a data sample

Toxicity

Not Available

Pathways

Not Available

Pharmacogenomic Effects/ADRs Browse all" title="About SNP Mediated Effects/ADRs" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">

Not Available

Interactions

Drug Interactions Learn More" title="About Drug Interactions" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Drug	Interaction
Integrate drug-drug interactions in your software
Abciximab	The therapeutic efficacy of Coagulation Factor IX (Recombinant) can be decreased when used in combination with Abciximab.
Acenocoumarol	The therapeutic efficacy of Coagulation Factor IX (Recombinant) can be decreased when used in combination with Acenocoumarol.
Alpha-1-proteinase inhibitor	Alpha-1-proteinase inhibitor may increase the thrombogenic activities of Coagulation Factor IX (Recombinant).
Alteplase	The therapeutic efficacy of Coagulation Factor IX (Recombinant) can be decreased when used in combination with Alteplase.
Aminocaproic acid	The risk or severity of adverse effects can be increased when Aminocaproic acid is combined with Coagulation Factor IX (Recombinant).

Food Interactions

No interactions found.

Products

Drug product information from 10+ global regions

Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.

Access now

Access drug product information from over 10 global regions.

Access now

Brand Name Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Benefix	Injection, powder, for solution	2000 IU	Intravenous	Pfizer Europe Ma Eeig	2021-01-27	Not applicable
Benefix	Injection, powder, for solution	250 IU	Intravenous	Pfizer Europe Ma Eeig	2021-01-27	Not applicable
BeneFIX	Powder, for solution	2000 unit / vial	Intravenous	Pfizer Canada Ulc	2008-07-12	Not applicable
BeneFIX	Powder, for solution	500 unit / vial	Intravenous	Pfizer Canada Ulc	2007-04-14	Not applicable
Benefix	Injection, powder, for solution	1500 IU	Intravenous	Pfizer Europe Ma Eeig	2021-01-27	Not applicable

Mixture Products

Name	Ingredients	Dosage	Route	Labeller	Marketing Start	Marketing End
BeneFIX	Coagulation Factor IX (Recombinant) (500 [iU]/5mL) + Isopropyl alcohol (70 mL/100mL)	Injection, powder, lyophilized, for solution; Kit	Intravenous; Topical	Wyeth BioPharma Division of Wyeth Pharmaceuticals LLC	1997-02-01	Not applicable
BeneFIX	Coagulation Factor IX (Recombinant) (500 [iU]/5mL) + Isopropyl alcohol (0.42 mL/1)	Kit	Intravenous; Topical	Wyeth BioPharma Division of Wyeth Pharmaceuticals Inc., a subsidiary of Pfizer Inc.	1997-02-01	2010-12-16
BeneFIX	Coagulation Factor IX (Recombinant) (3000 [iU]/5mL) + Isopropyl alcohol (70 mL/100mL)	Injection, powder, lyophilized, for solution; Kit	Intravenous; Topical	Wyeth BioPharma Division of Wyeth Pharmaceuticals LLC	2012-02-01	Not applicable
BeneFIX	Coagulation Factor IX (Recombinant) (1000 [iU]/5mL) + Isopropyl alcohol (0.42 mL/1)	Kit	Intravenous; Topical	Wyeth BioPharma Division of Wyeth Pharmaceuticals Inc., a subsidiary of Pfizer Inc.	1997-02-01	2010-12-16
BeneFIX	Coagulation Factor IX (Recombinant) (2000 [iU]/5mL) + Isopropyl alcohol (70 mL/100mL)	Injection, powder, lyophilized, for solution; Kit	Intravenous; Topical	Wyeth BioPharma Division of Wyeth Pharmaceuticals LLC	2007-07-06	Not applicable

Chemical Identifiers

UNII: 382L14738L
CAS number: 181054-95-5

References

Synthesis Reference

Volker Schellenberger, Joshua Silverman, Willem Stemmer, Chia-wei Wang, Benjamin Spink, Nathan Geething, Wayne To, "Coagulation factor IX compositions and methods of making and using same." U.S. Patent US20110046060, issued February 24, 2011.

US20110046060

General References

BIGGS R, DOUGLAS AS, MACFARLANE RG, DACIE JV, PITNEY WR, MERSKEY: Christmas disease: a condition previously mistaken for haemophilia. Br Med J. 1952 Dec 27;2(4799):1378-82. [Article]
Kurachi K, Davie EW: Isolation and characterization of a cDNA coding for human factor IX. Proc Natl Acad Sci U S A. 1982 Nov;79(21):6461-4. [Article]
FDA Approved Drug Products: BeneFIX [coagulation factor IX (recombinant)] lyophilized powder for solution, for intravenous use [Link]
DailyMed Label: IXINITY [coagulation factor IX (recombinant)] Lyophilized Powder for Solution for Intravenous Injection [Link]

External Links

UniProt: P00740
Genbank: K02402
KEGG Compound: C03101
PubChem Substance: 46508858
RxNav: 1300488
Therapeutic Targets Database: DAP000964
PharmGKB: PA164744952
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Factor_IX

FDA label

Download (18.9 MB)

MSDS

Download (125 KB)

Clinical Trials

Clinical Trials Learn More" title="About Clinical Trials" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">

Phase	Status	Purpose	Conditions	Count
4	Completed	Prevention	Coronavirus Disease 2019 (COVID‑19) / Hemophilia B	1
4	Completed	Treatment	Hemophilia B	3
3	Completed	Prevention	Hemophilia B	1
3	Completed	Treatment	Hemophilia B	7
3	Completed	Treatment	Severe Hemophilia B	2

Pharmacoeconomics

Manufacturers

Not Available

Packagers

CSL Behring LLC
Grifols SA
Hospira Inc.
Wyeth Pharmaceuticals

Dosage Forms

Form	Route	Strength
Injection, powder, for solution	Intravenous	1500 IU
Injection, powder, for solution	Intravenous	3000 IU
Injection, powder, lyophilized, for solution; kit	Intravenous; Topical
Injection, solution	Intravenous	1000 IU
Injection, solution	Intravenous	250 IU
Injection, solution	Intravenous	500 IU
Kit	Intravenous; Topical
Powder, for solution	Intravenous	1000 unit / vial
Powder, for solution	Intravenous	1500 unit / vial
Powder, for solution	Intravenous	2000 unit / vial
Powder, for solution	Intravenous	250 unit / vial
Powder, for solution	Intravenous	3000 unit / vial
Powder, for solution	Intravenous	500 unit / vial
Kit; liquid; powder, for solution	Intravenous
Injection, powder, for solution	Intravenous
Injection, solution	Intravenous	2000 iu
Injection, powder, for solution	Intravenous	275 IU/mL
Injection, powder, for solution	Intravenous	550 IU/mL
Injection, powder, for solution	Intravenous	69 IU/mL
Injection, powder, for solution	Intravenous	500 IU
Injection, powder, for solution	Intravenous	138 IU/mL
Injection, powder, for solution	Intravenous	1000 IU
Injection, powder, for solution	Intravenous	2000 IU
Injection, powder, lyophilized, for solution	Intravenous	1000 IU
Kit; powder, for solution	Intravenous	1000 IU/1
Kit; powder, for solution	Intravenous	2000 IU/1
Kit; powder, for solution	Intravenous	500 IU/1
Injection, powder, lyophilized, for solution	Intravenous	600 IU
Injection, powder, lyophilized, for solution; kit	Intravenous	1500 [iU]/5mL
Kit	Intravenous	1000 [iU]/5mL
Kit	Intravenous	1500 [iU]/5mL
Kit	Intravenous	2000 [iU]/5mL
Kit	Intravenous	250 [iU]/5mL
Kit	Intravenous	3000 [iU]/5mL
Kit	Intravenous	500 [iU]/5mL
Injection, powder, lyophilized, for solution	Intravenous	100000000 IU
Injection, powder, for solution	Intravenous	250 IU
Injection, powder, lyophilized, for solution	Intravenous	250 IU
Injection, powder, lyophilized, for solution	Intravenous	500 IU
Injection, powder, lyophilized, for solution; kit	Intravenous	125 [iU]/1mL
Injection, powder, lyophilized, for solution; kit	Intravenous	250 [iU]/1mL
Injection, powder, lyophilized, for solution; kit	Intravenous	500 [iU]/1mL
Injection, powder, lyophilized, for solution; kit	Intravenous	750 [iU]/1mL
Injection, powder, lyophilized, for solution; kit	Intravenous	1000 [iU]/5mL
Injection, powder, lyophilized, for solution; kit	Intravenous	2000 [iU]/5mL
Injection, powder, lyophilized, for solution; kit	Intravenous	250 [iU]/5mL
Injection, powder, lyophilized, for solution; kit	Intravenous	3000 [iU]/5mL
Injection, powder, lyophilized, for solution; kit	Intravenous	500 [iU]/5mL
Kit; powder, for solution	Intravenous	1000 unit / vial
Kit; powder, for solution	Intravenous	2000 unit / vial
Kit; powder, for solution	Intravenous	250 unit / vial
Kit; powder, for solution	Intravenous	3000 unit / vial
Kit; powder, for solution	Intravenous	500 unit / vial
Solution	Intravenous	2000.00 UI

Prices

Unit description	Cost	Unit
Alphanine sd 250-1500 unit vial	1.42USD	vial
Mononine 1000 unit vial	1.2USD	vial
Mononine 500 unit vial	1.2USD	vial
Benefix 2000 unit vial	1.12USD	vial
Benefix 1000 unit vial	1.0USD	vial
Benefix 250 unit vial	1.0USD	vial
Benefix 500 unit vial	1.0USD	vial

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Not Available

Properties

State

Liquid

Experimental Properties

Property	Value	Source
melting point (°C)	54 °C	Link, R.P., Castellino, F.J. Arch. Biochem. Biophsy. 227:259-265 (1983)
hydrophobicity	-0.431	Not Available
isoelectric point	5.20	Not Available

Targets

Build, predict & validate machine-learning models

Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.

Learn more

Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.

Learn more

Details1. Coagulation factor X

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Activator

General Function: Serine-type endopeptidase activity
Specific Function: Factor Xa is a vitamin K-dependent glycoprotein that converts prothrombin to thrombin in the presence of factor Va, calcium and phospholipid during blood clotting.
Gene Name: F10
Uniprot ID: P00742
Uniprot Name: Coagulation factor X
Molecular Weight: 54731.255 Da

References

Worfolk LA, Robinson RA, Tracy PB: Factor Xa interacts with two sites on monocytes with different functional activities. Blood. 1992 Oct 15;80(8):1989-97. [Article]
Jones KC, Mann KG: A model for the tissue factor pathway to thrombin. II. A mathematical simulation. J Biol Chem. 1994 Sep 16;269(37):23367-73. [Article]
Ambrosini G, Plescia J, Chu KC, High KA, Altieri DC: Activation-dependent exposure of the inter-EGF sequence Leu83-Leu88 in factor Xa mediates ligand binding to effector cell protease receptor-1. J Biol Chem. 1997 Mar 28;272(13):8340-5. [Article]
London FS, Walsh PN: Zymogen factor IX potentiates factor IXa-catalyzed factor X activation. Biochemistry. 2000 Aug 15;39(32):9850-8. [Article]
Scandella DH: Properties of anti-factor VIII inhibitor antibodies in hemophilia A patients. Semin Thromb Hemost. 2000;26(2):137-42. [Article]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Di Scipio RG, Kurachi K, Davie EW: Activation of human factor IX (Christmas factor). J Clin Invest. 1978 Jun;61(6):1528-38. [Article]

Details2. Coagulation factor XI

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Ligand

General Function: Serine-type endopeptidase activity
Specific Function: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Gene Name: F11
Uniprot ID: P03951
Uniprot Name: Coagulation factor XI
Molecular Weight: 70108.56 Da

References

Sun MF, Zhao M, Gailani D: Identification of amino acids in the factor XI apple 3 domain required for activation of factor IX. J Biol Chem. 1999 Dec 17;274(51):36373-8. [Article]
Gailani D, Ho D, Sun MF, Cheng Q, Walsh PN: Model for a factor IX activation complex on blood platelets: dimeric conformation of factor XIa is essential. Blood. 2001 May 15;97(10):3117-22. [Article]
Di Scipio RG, Kurachi K, Davie EW: Activation of human factor IX (Christmas factor). J Clin Invest. 1978 Jun;61(6):1528-38. [Article]

Details3. Coagulation factor VII

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Ligand

General Function: Serine-type peptidase activity
Specific Function: Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, o...
Gene Name: F7
Uniprot ID: P08709
Uniprot Name: Coagulation factor VII
Molecular Weight: 51593.465 Da

References

Baker DC, Robbe SL, Jacobson L, Manco-Johnson MJ, Holler L, Lefkowitz J: Hereditary deficiency of vitamin-K-dependent coagulation factors in Rambouillet sheep. Blood Coagul Fibrinolysis. 1999 Mar;10(2):75-80. [Article]
Hertzberg MS, Facey SL, Hogg PJ: An Arg/Ser substitution in the second epidermal growth factor-like module of factor IX introduces an O-linked carbohydrate and markedly impairs activation by factor XIa and factor VIIa/Tissue factor and catalytic efficiency of factor IXa. Blood. 1999 Jul 1;94(1):156-63. [Article]
Butenas S, van't Veer C, Mann KG: "Normal" thrombin generation. Blood. 1999 Oct 1;94(7):2169-78. [Article]
Celie PH, Lenting PJ, Mertens K: Hydrophobic contact between the two epidermal growth factor-like domains of blood coagulation factor IX contributes to enzymatic activity. J Biol Chem. 2000 Jan 7;275(1):229-34. [Article]
Shord SS, Lindley CM: Coagulation products and their uses. Am J Health Syst Pharm. 2000 Aug 1;57(15):1403-17; quiz 1418-20. [Article]
Di Scipio RG, Kurachi K, Davie EW: Activation of human factor IX (Christmas factor). J Clin Invest. 1978 Jun;61(6):1528-38. [Article]

Details4. Coagulation factor VIII

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Cofactor

General Function: Oxidoreductase activity
Specific Function: Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa.
Gene Name: F8
Uniprot ID: P00451
Uniprot Name: Coagulation factor VIII
Molecular Weight: 267007.42 Da

References

Neels JG, Bovenschen N, van Zonneveld AJ, Lenting PJ: Interaction between factor VIII and LDL receptor-related protein. Modulation of coagulation? Trends Cardiovasc Med. 2000 Jan;10(1):8-14. [Article]
Carr ME Jr, Martin EJ, Kuhn JG, Seremetis SV: Effects of recombinant factor VIIa on platelet function and clot structure in blood with deficient prothrombin conversion. Thromb Haemost. 2003 May;89(5):803-11. [Article]
Federici AB: The factor VIII/von Willebrand factor complex: basic and clinical issues. Haematologica. 2003 Jun;88(6):EREP02. [Article]
Kalashnikova LA, Berkovskii AL, Dobrynina LA, Sergeeva EV, Kozlov AA, Aleksandrova EN, Nasonov EL: [Clotting factor VIII in Sneddon syndrome]. Klin Med (Mosk). 2003;81(9):42-5. [Article]
Johansen RF, Sorensen B, Ingerslev J: Acquired haemophilia: dynamic whole blood coagulation utilized to guide haemostatic therapy. Haemophilia. 2006 Mar;12(2):190-7. [Article]
Di Scipio RG, Kurachi K, Davie EW: Activation of human factor IX (Christmas factor). J Clin Invest. 1978 Jun;61(6):1528-38. [Article]

Details5. Prothrombin

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Thrombospondin receptor activity
Specific Function: Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostas...
Gene Name: F2
Uniprot ID: P00734
Uniprot Name: Prothrombin
Molecular Weight: 70036.295 Da

References

Butenas S, van't Veer C, Mann KG: "Normal" thrombin generation. Blood. 1999 Oct 1;94(7):2169-78. [Article]
Kohler M: Thrombogenicity of prothrombin complex concentrates. Thromb Res. 1999 Aug 15;95(4 Suppl 1):S13-7. [Article]
Seitz R, Dodt J: Virus safety of prothrombin complex concentrates and factor IX concentrates. Thromb Res. 1999 Aug 15;95(4 Suppl 1):S19-23. [Article]
Samis JA, Ramsey GD, Walker JB, Nesheim ME, Giles AR: Proteolytic processing of human coagulation factor IX by plasmin. Blood. 2000 Feb 1;95(3):943-51. [Article]
Bauer KA, Humphries S, Smillie B, Li L, Cooper JA, Barzegar S, Rosenberg RD, Miller GJ: Prothrombin activation is increased among asymptomatic carriers of the prothrombin G20210A and factor V Arg506Gln mutations. Thromb Haemost. 2000 Sep;84(3):396-400. [Article]

Details6. Prolow-density lipoprotein receptor-related protein 1

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Receptor activity
Specific Function: Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Required for early embryonic development. Involved in cellular lipid homeostasis. Involved in the plasma clearance...
Gene Name: LRP1
Uniprot ID: Q07954
Uniprot Name: Prolow-density lipoprotein receptor-related protein 1
Molecular Weight: 504601.695 Da

References

Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
Rohlena J, Kolkman JA, Boertjes RC, Mertens K, Lenting PJ: Residues Phe342-Asn346 of activated coagulation factor IX contribute to the interaction with low density lipoprotein receptor-related protein. J Biol Chem. 2003 Mar 14;278(11):9394-401. Epub 2003 Jan 9. [Article]

Details7. Vitamin K-dependent gamma-carboxylase

Kind: Protein
Organism: Humans
Pharmacological action: Unknown

General Function: Gamma-glutamyl carboxylase activity
Specific Function: Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vit...
Gene Name: GGCX
Uniprot ID: P38435
Uniprot Name: Vitamin K-dependent gamma-carboxylase
Molecular Weight: 87560.065 Da

References

Lin PJ, Straight DL, Stafford DW: Binding of the factor IX gamma-carboxyglutamic acid domain to the vitamin K-dependent gamma-glutamyl carboxylase active site induces an allosteric effect that may ensure processive carboxylation and regulate the release of carboxylated product. J Biol Chem. 2004 Feb 20;279(8):6560-6. Epub 2003 Dec 2. [Article]
Wu SM, Mutucumarana VP, Geromanos S, Stafford DW: The propeptide binding site of the bovine gamma-glutamyl carboxylase. J Biol Chem. 1997 May 2;272(18):11718-22. [Article]
Rehemtulla A, Roth DA, Wasley LC, Kuliopulos A, Walsh CT, Furie B, Furie BC, Kaufman RJ: In vitro and in vivo functional characterization of bovine vitamin K-dependent gamma-carboxylase expressed in Chinese hamster ovary cells. Proc Natl Acad Sci U S A. 1993 May 15;90(10):4611-5. [Article]
Stanley TB, Wu SM, Houben RJ, Mutucumarana VP, Stafford DW: Role of the propeptide and gamma-glutamic acid domain of factor IX for in vitro carboxylation by the vitamin K-dependent carboxylase. Biochemistry. 1998 Sep 22;37(38):13262-8. [Article]
Stanley TB, Stafford DW, Olivera BM, Bandyopadhyay PK: Identification of a vitamin K-dependent carboxylase in the venom duct of a Conus snail. FEBS Lett. 1997 Apr 21;407(1):85-8. [Article]

Drug created at June 13, 2005 13:24 / Updated at January 02, 2024 23:41

Coagulation Factor IX (Recombinant)

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Pharmacoeconomics

Properties

Targets

References

References

References

References

References

References

References