Veltuzumab
Star0
This drug entry is a stub and has not been fully annotated. It is scheduled to be annotated soon.
Identification
- Generic Name
- Veltuzumab
- DrugBank Accession Number
- DB05656
- Background
Veltuzumab is a monoclonal antibody which, as of October 2009, is undergoing Phase I/II clinical trials for the treatment of non-Hodgkin's lymphoma.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) - Protein Structure
- Protein Chemical Formula
- C6458H9918N1706O2026S46
- Protein Average Weight
- Not Available
- Sequences
>8932_H|veltuzumab|Humanized||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-234)+CH2(235-344)+CH3(345-451))|||||||451||||MW 49467.6|MW 49467.6| QVQLQQSGAEVKKPGSSVKVSCKASGYTFTSYNMHWVKQAPGQGLEWIGAIYPGNGDTSY NQKFKGKATLTADESTNTAYMELSSLRSEDTAFYYCARSTYYGGDWYFDVWGQGTTVTVS SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>8932_L|veltuzumab|Humanized||L-KAPPA (V-KAPPA(1-106)+C-KAPPA(107-213))|||||||213||||MW 23205.8|MW 23205.8| DIQLTQSPSSLSASVGDRVTMTCRASSSVSYIHWFQQKPGKAPKPWIYATSNLASGVPVR FSGSGSGTDYTFTISSLQPEDIATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format- Synonyms
- Veltuzumab
- External IDs
- hA20
- IMMU-106
Pharmacology
- Indication
Investigated for use/treatment in lymphoma (non-hodgkin's).
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Not Available
- Mechanism of action
- Not Available
- Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs Browse all" title="About SNP Mediated Effects/ADRs" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">
- Not Available
Interactions
- Drug Interactions Learn More" title="About Drug Interactions" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Veltuzumab. Adalimumab The risk or severity of adverse effects can be increased when Adalimumab is combined with Veltuzumab. Aducanumab The risk or severity of adverse effects can be increased when Veltuzumab is combined with Aducanumab. Alemtuzumab The risk or severity of adverse effects can be increased when Alemtuzumab is combined with Veltuzumab. Alirocumab The risk or severity of adverse effects can be increased when Veltuzumab is combined with Alirocumab. - Food Interactions
- Not Available
Categories
- Drug Categories
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- BPD4DGQ314
- CAS number
- 728917-18-8
References
- General References
- Not Available
- External Links
- Wikipedia
- Veltuzumab
Clinical Trials
- Clinical Trials Learn More" title="About Clinical Trials" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">
Phase Status Purpose Conditions Count 2 Terminated Treatment Rheumatoid Arthritis 1 1, 2 Completed Treatment B-Cell Lymphoma / Chronic Lymphocytic Leukemia / Follicular Lymphoma ( FL) / Leukemia, B-Cell, Chronic / Low Grade Lymphoma / Lymphoma, Intermediate-Grade / Lymphoma, Large Cell / Lymphoma, Lymphoplasmacytoid, CLL / Lymphoma, Small-Cell / Mixed-cell type lymphoma / Non-Hodgkin's Lymphoma (NHL) / Non-Hodgkin's Lymphomas / Prolymphocytic Leukaemia (PLL) / Small Lymphocytic Leukemia (SLL) / Small Lymphocytic Lymphoma 1 1, 2 Completed Treatment Lymphoma 1 1, 2 Completed Treatment Lymphoma, Diffuse / Lymphoma, Diffuse, Mixed Lymphocytic-Histiocytic / Non-Hodgkin's Lymphoma (NHL) / Non-Hodgkin's Lymphomas 1 1, 2 Completed Treatment Non-Hodgkin's Lymphoma (NHL) / Non-Hodgkin's Lymphomas 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Drug created at November 18, 2007 18:26 / Updated at January 14, 2023 19:03