NAV

Mogamulizumab

Identification

Summary

Mogamulizumab is a monoclonal antibody used to treat relapsed or refractory mycosis fungoides or Sézary syndrome after attempting one other therapy.

Brand Names
Poteligeo
Generic Name
Mogamulizumab
DrugBank Accession Number
DB12498
Background

Mogamulizumab is a humanized monoclonal antibody (mAb) directed against CC chemokine receptor 4 (CCR4) for the treatment of Mycosis Fungoides (MF) and Sézary Syndrome (SS), the most common subtypes of cutaneous T-cell lymphoma. Cutaneous T-cell lymphomas occur when certain white blood cells, called T cells, become cancerous; these cancers typically affect the skin, causing various types of skin lesions.8

On August 8 2018, the U.S. Food and Drug Administration (FDA) approved mogamulizumab injection (also known as Poteligeo) for intravenous use for the treatment of adult patients with relapsed or refractory mycosis fungoides (MF) or Sézary syndrome (SS) after at least one prior systemic therapy.7 It was approved for the same indications in Canada in June 2022.12

Mogamulizumab is derived from Kyowa Hakko Kirin's POTELLIGENT (®) technology, which produces antibodies with enhanced antibody-dependent cell-mediated cytotoxicity (ADCC) activity. Approval in Japan was granted on April 30 2012 by the Japanese Ministry of Health, Labour and Welfare for patients with relapsed or refractory CCR4-positive adult T-cell leukemia-lymphoma.2

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Chemical Formula
Not Available
Protein Average Weight
Not Available
Sequences
>Heavy Chain
EVQLVESGGDLVQPGRSLRLSCAASGFIFSNYGMSWVRQAPGKGLEWVATISSASTYSYY
PDSVKGRFTISRDNAKNSLYLQMNSLRVEDTALYYCGRHSDGNFAFGYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain
DVLMTQSPLSLPVTPGEPASISCRSSRNIVHINGDTYLEWYLQKPGQSPQLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSLLPWTFGQGTKVEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
References:
  1. KEGG DRUG: Mogamulizumab [Link]
Download FASTA Format
Synonyms
  • Mogamulizumab
  • mogamulizumab-kpkc
External IDs
  • AMG-761
  • KM-8761
  • KM8761
  • KW 0761
  • KW-0761
Poor quality drug data slowing you down?
Unlock 38% more drug discovery time and eliminate decision-making doubts with this one-stop guide to quality drug data.
Download eBook
Poor quality drug data slowing you down?
Download eBook

Pharmacology

Indication

Mogamulizumab is indicated for the treatment of adult patients with relapsed or refractory mycosis fungoides (MF) or Sézary syndrome (SS) after at least one prior systemic therapy.11,12

Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Indication TypeIndicationCombined Product DetailsApproval LevelAge GroupPatient CharacteristicsDose Form
Treatment ofRefractory mycosis fungoides/sezary syndrome•••••••••••••••••••••••• •• •• ••••• ••• ••••• •••••••• ••••••••••••••••
Treatment ofRelapsed mycosis fungoides/sezary syndrome•••••••••••••••••••••••• •• •• ••••• ••• ••••• •••••••• ••••••••••••••••
Contraindications & Blackbox Warnings
Prevent Adverse Drug Events Today
Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events with our Clinical API
Learn more
Pharmacodynamics

This drug is a CC chemokine receptor 4 (CCR4) antagonist. It is a monoclonal antibody which blocks T cell proliferation, which leads to malignancy.1,6 CCR4 is a chemokine receptor that is preferentially expressed by Th2 and regulatory T (Treg) cells. In response to its ligands, CCL17 (TARC) and CCL22 (MDC), CCR4 promotes T-cell migration to extranodal sites, including the skin.6

Mechanism of action

Mogamulizumab selectively binds to and inhibits the activity of CCR4, which may block CCR4-mediated signal transduction pathways and, so, chemokine-mediated cellular migration and proliferation of T cells, as well as chemokine-mediated angiogenesis. Additionally, this agent may induce antibody-dependent cell-mediated cytotoxicity (ADCC) against CCR4-positive T cells. CCR4, a G-coupled-protein receptor for C-C chemokines such MIP-1, RANTES, TARC and MCP-1, is expressed on the surfaces of some types of T cells, endothelial cells, and certain types of neurons. CCR4, also known as CD194, may be overexpressed on adult T-cell lymphoma (ATL) and peripheral T-cell lymphoma (PTCL) cells 10. In addition to directly targeting malignant T cells expressing CCR4, mogamulizumab depletes Treg cells, an important therapeutic target in many human cancers because of their role in suppressing host antitumor immunity 6.

TargetActionsOrganism
AC-C chemokine receptor type 4
antagonist
Humans
Absorption

Following repeated dosing of the approved recommended dosage, steady-state concentrations were reached after 8 doses (12 weeks), and the systemic accumulation was 1.6-fold. At steady state, the peak concentration (Cmax,ss) is 32 (68%) μg/mL, the trough concentration (Cmin,ss) is 11 (239%) μg/mL, and AUCss is 5577 (125%) μg•hr/mL.11

Volume of distribution

The central volume of distribution is 3.6 L.11

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

The terminal half-life is 17 days.11

Clearance

Clearance is 12 mL/h.11

Adverse Effects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!
See the data
Improve decision support & research outcomes with our structured adverse effects data.
See a data sample
Toxicity

The most common adverse reactions (reported in ≥20% of patients randomized to mogamulizumab) were rash (including drug eruption), infusion-related reactions, fatigue, diarrhea, upper respiratory tract infection and musculoskeletal pain.11 Due to various adverse effects related to this drug, the adverse reactions have been categorized by organ system. Because of the risk of serious/fatal ADRs, patients administered mogamulizumab should be carefully monitored.3

Upper respiratory tract infection: This may occur due to decreased immunity following the administration of this drug. Monitor for signs of respiratory infection including fever, cough and shortness of breath.9

Dermatological: Patients must contact their healthcare provider immediately if they experience a new or worsening skin rash. Treatment should be temporarily interrupted for moderate or severe skin rashes and permanently discontinued for a life-threatening rash. Fatal and life-threatening skin adverse reactions, including Stevens-Johnson syndrome (SJS) and toxic epidermal necrolysis (TEN), have occurred in recipients of mogamulizumab. Rash (drug eruption) is one of the most common adverse reactions associated with mogamulizumab.9,11 Infusion Reactions: Patients must contact their healthcare provider immediately for signs or symptoms of infusion reactions. Treatment should be suspended for any infusion reaction and permanently discontinued for any life-threatening infusion reaction.9

Infections: Patients must contact their healthcare provider if they experience fever or other signs of infection. Infections should be monitored and treated promptly.9

Autoimmune Complications: Immune-mediated or possibly immune-mediated reactions have included myositis, myocarditis, polymyositis, hepatitis, pneumonitis, and a variant of Guillain- Barré syndrome.11 Patients must notify their healthcare provider of any history of autoimmune disease. Treatment should be suspended or permanently discontinued as appropriate.9 Fatal and life-threatening immune-mediated complications have been reported in recipients of this drug.11

Musculoskeletal pain: This drug may cause musculoskeletal pain.11

A note on complications of allogeneic hematopoietic stem cell transplantation: Patients must be aware of the possible risk of post-transplant complications when taking this agent. Patients should be monitored for severe acute graft-versus-host disease (GVHD) and steroid-refractory GVHD.

Females of Reproductive Potential: Females who are able to become pregnant should use an effective method of birth control during treatment with Poteligeo and for at least three months after the last dose.9

Pathways
Not Available
Pharmacogenomic Effects/ADRs Browse all" title="About SNP Mediated Effects/ADRs" id="snp-actions-info" class="drug-info-popup" href="javascript:void(0);">
Not Available

Interactions

Drug Interactions Learn More" title="About Drug Interactions" id="structured-interactions-info" class="drug-info-popup" href="javascript:void(0);">
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
Integrate drug-drug
interactions in your software
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Mogamulizumab.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Mogamulizumab.
AducanumabThe risk or severity of adverse effects can be increased when Aducanumab is combined with Mogamulizumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Mogamulizumab.
AlirocumabThe risk or severity of adverse effects can be increased when Alirocumab is combined with Mogamulizumab.
Food Interactions
No interactions found.

Products

Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
PoteligeoInjection4 mg/1mLIntravenousKyowa Kirin, Inc.2018-08-08Not applicableUS flag
PoteligeoInjection, solution, concentrate4 mg/mlIntravenousKyowa Kirin Holdings B.V.2020-12-16Not applicableEU flag
PoteligeoSolution4 mg / mLIntravenousKyowa Kirin, Inc.Not applicableNot applicableCanada flag

Categories

ATC Codes
L01FX09 — Mogamulizumab
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
YI437801BE
CAS number
1159266-37-1

References

General References
  1. Makita S, Tobinai K: Mogamulizumab for the treatment of T-cell lymphoma. Expert Opin Biol Ther. 2017 Sep;17(9):1145-1153. doi: 10.1080/14712598.2017.1347634. Epub 2017 Jul 3. [Article]
  2. Beck A, Reichert JM: Marketing approval of mogamulizumab: a triumph for glyco-engineering. MAbs. 2012 Jul-Aug;4(4):419-25. doi: 10.4161/mabs.20996. Epub 2012 Jul 1. [Article]
  3. Ishitsuka K, Yurimoto S, Kawamura K, Tsuji Y, Iwabuchi M, Takahashi T, Tobinai K: Safety and efficacy of mogamulizumab in patients with adult T-cell leukemia-lymphoma in Japan: interim results of postmarketing all-case surveillance. Int J Hematol. 2017 Oct;106(4):522-532. doi: 10.1007/s12185-017-2270-9. Epub 2017 Jun 9. [Article]
  4. Sato T, Coler-Reilly ALG, Yagishita N, Araya N, Inoue E, Furuta R, Watanabe T, Uchimaru K, Matsuoka M, Matsumoto N, Hasegawa Y, Yamano Y: Mogamulizumab (Anti-CCR4) in HTLV-1-Associated Myelopathy. N Engl J Med. 2018 Feb 8;378(6):529-538. doi: 10.1056/NEJMoa1704827. [Article]
  5. Ni X, Jorgensen JL, Goswami M, Challagundla P, Decker WK, Kim YH, Duvic MA: Reduction of regulatory T cells by Mogamulizumab, a defucosylated anti-CC chemokine receptor 4 antibody, in patients with aggressive/refractory mycosis fungoides and Sezary syndrome. Clin Cancer Res. 2015 Jan 15;21(2):274-85. doi: 10.1158/1078-0432.CCR-14-0830. Epub 2014 Nov 5. [Article]
  6. Wilcox RA: Mogamulizumab: 2 birds, 1 stone. Blood. 2015 Mar 19;125(12):1847-8. doi: 10.1182/blood-2015-02-625251. [Article]
  7. FDA approves treatment for two rare types of non-Hodgkin lymphoma [Link]
  8. Sezary Syndrome [Link]
  9. POTELIGEO [Link]
  10. Mogamulizumab NCI [Link]
  11. FDA Approved Drug Products: Poteligeo (mogamulizumab-kpkc) injection for intravenous use [Link]
  12. Health Canada Product Monograph: Poteligeo (mogamulizumab) for intravenous injection [Link]
PubChem Substance
347911339
RxNav
2054077
Wikipedia
Mogamulizumab

Clinical Trials

Clinical Trials Learn More" title="About Clinical Trials" id="clinical-trials-info" class="drug-info-popup" href="javascript:void(0);">
PhaseStatusPurposeConditionsCount
3CompletedTreatmentCutaneous T-Cell Lymphoma (CTCL)1
3TerminatedTreatmentHTLV-1 Associated Myelopathy1
2Active Not RecruitingTreatmentCutaneous T-Cell Lymphoma, Relapsed / Refractory Cutaneous T-cell Lymphoma1
2CompletedTreatmentAdult T-Cell Lymphoma/Leukemia3
2CompletedTreatmentCutaneous T-Cell Lymphoma (CTCL) / Peripheral T-Cell Lymphoma (PTCL)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage Forms
FormRouteStrength
InjectionIntravenous4 mg/1mL
Injection, solution, concentrateIntravenous4 MG/ML
SolutionIntravenous4 mg / mL
Prices
Not Available
Patents
Not Available

Properties

State
Not Available
Experimental Properties
Not Available

Targets

Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Details1. C-C chemokine receptor type 4
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Antagonist
General Function
High affinity receptor for the C-C type chemokines CCL17/TARC, CCL22/MDC and CKLF isoform 1/CKLF1. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival.
Specific Function
C-c chemokine binding
Gene Name
CCR4
Uniprot ID
P51679
Uniprot Name
C-C chemokine receptor type 4
Molecular Weight
41402.385 Da
References
  1. Makita S, Tobinai K: Mogamulizumab for the treatment of T-cell lymphoma. Expert Opin Biol Ther. 2017 Sep;17(9):1145-1153. doi: 10.1080/14712598.2017.1347634. Epub 2017 Jul 3. [Article]
  2. Beck A, Reichert JM: Marketing approval of mogamulizumab: a triumph for glyco-engineering. MAbs. 2012 Jul-Aug;4(4):419-25. doi: 10.4161/mabs.20996. Epub 2012 Jul 1. [Article]
  3. Ishitsuka K, Yurimoto S, Kawamura K, Tsuji Y, Iwabuchi M, Takahashi T, Tobinai K: Safety and efficacy of mogamulizumab in patients with adult T-cell leukemia-lymphoma in Japan: interim results of postmarketing all-case surveillance. Int J Hematol. 2017 Oct;106(4):522-532. doi: 10.1007/s12185-017-2270-9. Epub 2017 Jun 9. [Article]
  4. Wilcox RA: Mogamulizumab: 2 birds, 1 stone. Blood. 2015 Mar 19;125(12):1847-8. doi: 10.1182/blood-2015-02-625251. [Article]

Drug created at October 20, 2016 22:38 / Updated at December 01, 2022 11:27