Gamma-aminobutyric acid receptor subunit delta
Details
- Name
- Gamma-aminobutyric acid receptor subunit delta
- Synonyms
- GABA(A) receptor subunit delta
- Gene Name
- GABRD
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012501|Gamma-aminobutyric acid receptor subunit delta MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAGYARNFRPGIG GPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML DLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH FHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKQKAKVKVSRPRAEMDVRNAI VLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARLR PIDADTIDIYARAVFPAAFAAVNVIYWAAYAM
- Number of residues
- 452
- Molecular Weight
- 50707.835
- Theoretical pI
- 8.73
- GO Classification
- Functionschloride channel activity / extracellular ligand-gated ion channel activity / GABA-A receptor activityProcesseschloride transmembrane transport / neurological system process / regulation of membrane potential / signal transduction / synaptic transmission / transportComponentscell junction / chloride channel complex / GABA-A receptor complex / integral component of plasma membrane / neuron projection / postsynaptic membrane / synapse
- General Function
- Gaba-a receptor activity
- Specific Function
- GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
- Pfam Domain Function
- Transmembrane Regions
- 249-271 275-297 309-331 430-452
- Cellular Location
- Cell junction
- Gene sequence
>lcl|BSEQ0012502|Gamma-aminobutyric acid receptor subunit delta (GABRD) ATGGACGCGCCCGCCCGGCTGCTGGCCCCGCTCCTGCTCCTCTGCGCGCAGCAGCTCCGC GGCACCAGAGCGATGAATGACATCGGCGACTACGTGGGCTCCAACCTGGAGATCTCCTGG CTCCCCAACCTGGACGGGCTGATAGCCGGCTACGCCCGCAACTTCCGGCCTGGCATCGGA GGCCCCCCCGTGAATGTGGCCCTTGCCCTGGAGGTGGCCAGCATCGACCACATCTCAGAG GCCAACATGGAGTACACCATGACGGTGTTCCTGCACCAGAGCTGGCGGGACAGCAGGCTC TCCTACAACCACACCAACGAGACCCTGGGTCTGGACAGCCGCTTCGTGGACAAGCTGTGG CTGCCCGACACCTTCATCGTGAACGCCAAGTCGGCCTGGTTCCACGACGTGACGGTGGAG AACAAGCTCATCCGGCTGCAGCCCGACGGCGTGATCCTGTACAGCATCCGAATCACCTCC ACTGTGGCCTGCGACATGGACCTGGCCAAATACCCCATGGACGAGCAGGAGTGCATGCTG GACCTGGAGAGCTACGGTTACTCATCGGAGGACATCGTCTACTACTGGTCGGAGAGCCAG GAGCACATCCACGGGCTGGACAAGCTGCAGCTGGCGCAGTTCACCATCACCAGCTACCGC TTCACCACGGAGCTGATGAACTTCAAGTCCGCTGGCCAGTTCCCACGGCTCAGCCTGCAC TTCCACCTGCGGAGGAACCGCGGCGTGTACATCATCCAATCCTACATGCCCTCCGTCCTG CTGGTCGCCATGTCCTGGGTCTCCTTCTGGATCAGCCAGGCGGCGGTGCCCGCCAGGGTG TCTCTAGGCATCACCACGGTGCTGACGATGACCACGCTCATGGTCAGTGCCCGCTCCTCC CTGCCACGGGCATCAGCCATCAAGGCACTGGACGTCTACTTCTGGATCTGCTATGTCTTC GTGTTTGCCGCCCTGGTGGAGTACGCCTTTGCTCATTTCAACGCCGACTACAGGAAGAAG CAGAAGGCCAAGGTCAAGGTCTCCAGGCCGAGGGCAGAGATGGACGTGAGGAACGCCATT GTCCTCTTCTCCCTCTCTGCTGCCGGCGTCACGCAGGAGCTGGCCATCTCCCGCCGGCAG CGCCGCGTCCCGGGGAACCTGATGGGCTCCTACAGGTCGGTGGGGGTGGAGACAGGGGAG ACGAAGAAGGAGGGGGCAGCCCGCTCAGGAGGCCAGGGGGGCATCCGTGCCCGGCTCAGG CCCATCGACGCAGACACCATTGACATTTACGCCCGCGCTGTGTTCCCTGCGGCGTTTGCG GCCGTCAATGTCATCTACTGGGCGGCATACGCCATGTGA
- Chromosome Location
- 1
- Locus
- 1p|1p36.3
- External Identifiers
Resource Link UniProtKB ID O14764 UniProtKB Entry Name GBRD_HUMAN GenBank Protein ID 2388693 GenBank Gene ID AF016917 HGNC ID HGNC:4084 - General References
- Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Dibbens LM, Feng HJ, Richards MC, Harkin LA, Hodgson BL, Scott D, Jenkins M, Petrou S, Sutherland GR, Scheffer IE, Berkovic SF, Macdonald RL, Mulley JC: GABRD encoding a protein for extra- or peri-synaptic GABAA receptors is a susceptibility locus for generalized epilepsies. Hum Mol Genet. 2004 Jul 1;13(13):1315-9. Epub 2004 Apr 28. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01567 Fludiazepam experimental, illicit yes potentiator Details DB00898 Ethanol approved unknown Details DB01189 Desflurane approved yes positive allosteric modulator Details DB00404 Alprazolam approved, illicit, investigational yes positive allosteric modulator Details DB00237 Butabarbital approved, illicit yes positive allosteric modulator Details DB00475 Chlordiazepoxide approved, illicit, investigational yes positive allosteric modulator Details DB00349 Clobazam approved, illicit yes positive allosteric modulator Details DB01068 Clonazepam approved, illicit yes positive allosteric modulator Details DB00628 Clorazepic acid approved, illicit yes positive allosteric modulator Details DB00186 Lorazepam approved yes positive allosteric modulator Details DB00189 Ethchlorvynol approved, illicit, withdrawn yes positive allosteric modulator Details DB00228 Enflurane approved, investigational, vet_approved yes potentiator Details DB00231 Temazepam approved, investigational yes positive allosteric modulator Details DB00241 Butalbital approved, illicit yes positive allosteric modulator Details DB00292 Etomidate approved yes positive allosteric modulator Details DB00306 Talbutal approved, illicit yes positive allosteric modulator Details DB00312 Pentobarbital approved, investigational, vet_approved yes positive allosteric modulator Details DB00371 Meprobamate approved, illicit yes positive allosteric modulator Details DB00402 Eszopiclone approved, investigational yes positive allosteric modulator Details DB00463 Metharbital withdrawn yes positive allosteric modulator Details DB00753 Isoflurane approved, vet_approved yes positive allosteric modulator Details DB00794 Primidone approved, vet_approved yes positive allosteric modulator Details DB00801 Halazepam approved, illicit, withdrawn yes positive allosteric modulator Details DB00818 Propofol approved, investigational, vet_approved yes positive allosteric modulator Details DB00829 Diazepam approved, illicit, investigational, vet_approved yes positive allosteric modulator Details DB00842 Oxazepam approved yes positive allosteric modulator Details DB01028 Methoxyflurane approved, investigational, vet_approved, withdrawn yes positive allosteric modulator Details DB01107 Methyprylon approved, illicit, withdrawn yes positive allosteric modulator Details DB01159 Halothane approved, vet_approved yes positive allosteric modulator Details DB01205 Flumazenil approved yes positive allosteric modulator Details DB01215 Estazolam approved, illicit yes positive allosteric modulator Details DB01236 Sevoflurane approved, vet_approved yes agonist Details DB01437 Glutethimide approved, illicit yes positive allosteric modulator Details DB01588 Prazepam approved, illicit yes positive allosteric modulator Details DB01589 Quazepam approved, illicit yes positive allosteric modulator Details DB00543 Amoxapine approved unknown binder Details DB01708 Prasterone approved, investigational, nutraceutical unknown antagonist Details DB11582 Thiocolchicoside experimental yes antagonist Details DB09118 Stiripentol approved yes agonistpositive allosteric modulator Details DB01956 Taurine approved, nutraceutical yes agonist Details DB00555 Lamotrigine approved, investigational unknown antagonistinducer Details DB11901 Apalutamide approved, investigational no antagonist Details DB11859 Brexanolone approved, investigational yes positive allosteric modulator Details DB01043 Memantine approved, investigational unknown binder Details DB00603 Medroxyprogesterone acetate approved, investigational unknown inhibitor Details DB00252 Phenytoin approved, vet_approved unknown Details DB00683 Midazolam approved, illicit yes positive allosteric modulator Details DB00690 Flurazepam approved, illicit, investigational yes positive allosteric modulator Details DB00897 Triazolam approved, investigational yes positive allosteric modulator Details DB01558 Bromazepam approved, illicit, investigational yes positive allosteric modulator Details DB01595 Nitrazepam approved yes positive allosteric modulator Details DB01489 Camazepam experimental, illicit yes positive allosteric modulator Details DB01511 Delorazepam experimental, illicit yes positive allosteric modulator Details DB01544 Flunitrazepam approved, illicit yes positive allosteric modulator Details DB09166 Etizolam experimental yes positive allosteric modulator Details DB13437 Medazepam experimental yes positive allosteric modulator Details DB13837 Doxefazepam experimental yes positive allosteric modulator Details DB13872 Lormetazepam approved yes positive allosteric modulator Details DB14028 Nordazepam experimental yes positive allosteric modulator Details DB00546 Adinazolam experimental yes positive allosteric modulator Details DB01545 Ethyl loflazepate experimental, illicit yes positive allosteric modulator Details DB01553 Cloxazolam experimental yes positive allosteric modulator Details DB01559 Clotiazepam approved, illicit yes positive allosteric modulator Details DB01587 Ketazolam approved yes positive allosteric modulator Details DB01594 Cinolazepam experimental yes positive allosteric modulator Details DB09017 Brotizolam investigational, withdrawn yes positive allosteric modulator Details DB13335 Pinazepam experimental yes positive allosteric modulator Details DB13643 Loprazolam experimental yes positive allosteric modulator Details DB14672 Oxazepam acetate experimental yes positive allosteric modulator Details DB12537 1,2-Benzodiazepine approved, investigational unknown positive allosteric modulator Details DB14715 Cinazepam experimental yes positive allosteric modulator Details DB14719 Bentazepam experimental yes positive allosteric modulator Details DB15489 Mexazolam experimental yes positive allosteric modulator Details DB12404 Remimazolam approved, investigational yes positive allosteric modulator Details DB05087 Ganaxolone approved, investigational yes positive allosteric modulator Details DB15490 Zuranolone approved, experimental yes positive allosteric modulator Details