Interleukin-2 receptor subunit alpha

Details

Name
Interleukin-2 receptor subunit alpha
Synonyms
  • IL-2 receptor subunit alpha
  • p55
  • TAC antigen
Gene Name
IL2RA
Organism
Humans
Amino acid sequence
>lcl|BSEQ0018991|Interleukin-2 receptor subunit alpha
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Number of residues
272
Molecular Weight
30818.915
Theoretical pI
6.49
GO Classification
Functions
drug binding / interleukin-2 binding / interleukin-2 receptor activity
Processes
activation of MAPKK activity / activation-induced cell death of T cells / apoptotic process / axon guidance / cell proliferation / cell surface receptor signaling pathway / epidermal growth factor receptor signaling pathway / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / immune response / inflammatory response / inflammatory response to antigenic stimulus / innate immune response / insulin receptor signaling pathway / MAPK cascade / negative regulation of defense response to virus / negative regulation of immune response / negative regulation of inflammatory response / negative regulation of T cell proliferation / neurotrophin TRK receptor signaling pathway / Notch signaling pathway / positive regulation of activated T cell proliferation / positive regulation of T cell differentiation / Ras protein signal transduction / regulation of T cell homeostatic proliferation / regulation of T cell tolerance induction / small GTPase mediated signal transduction / vascular endothelial growth factor receptor signaling pathway
Components
external side of plasma membrane / integral component of membrane / intracellular / plasma membrane
General Function
Interleukin-2 receptor activity
Specific Function
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T cells.
Pfam Domain Function
Transmembrane Regions
241-259
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0018992|Interleukin-2 receptor subunit alpha (IL2RA)
ATGGATTCATACCTGCTGATGTGGGGACTGCTCACGTTCATCATGGTGCCTGGCTGCCAG
GCAGAGCTCTGTGACGATGACCCGCCAGAGATCCCACACGCCACATTCAAAGCCATGGCC
TACAAGGAAGGAACCATGTTGAACTGTGAATGCAAGAGAGGTTTCCGCAGAATAAAAAGC
GGGTCACTCTATATGCTCTGTACAGGAAACTCTAGCCACTCGTCCTGGGACAACCAATGT
CAATGCACAAGCTCTGCCACTCGGAACACAACGAAACAAGTGACACCTCAACCTGAAGAA
CAGAAAGAAAGGAAAACCACAGAAATGCAAAGTCCAATGCAGCCAGTGGACCAAGCGAGC
CTTCCAGGTCACTGCAGGGAACCTCCACCATGGGAAAATGAAGCCACAGAGAGAATTTAT
CATTTCGTGGTGGGGCAGATGGTTTATTATCAGTGCGTCCAGGGATACAGGGCTCTACAC
AGAGGTCCTGCTGAGAGCGTCTGCAAAATGACCCACGGGAAGACAAGGTGGACCCAGCCC
CAGCTCATATGCACAGGTGAAATGGAGACCAGTCAGTTTCCAGGTGAAGAGAAGCCTCAG
GCAAGCCCCGAAGGCCGTCCTGAGAGTGAGACTTCCTGCCTCGTCACAACAACAGATTTT
CAAATACAGACAGAAATGGCTGCAACCATGGAGACGTCCATATTTACAACAGAGTACCAG
GTAGCAGTGGCCGGCTGTGTTTTCCTGCTGATCAGCGTCCTCCTCCTGAGTGGGCTCACC
TGGCAGCGGAGACAGAGGAAGAGTAGAAGAACAATCTAG
Chromosome Location
10
Locus
10p15-p14
External Identifiers
ResourceLink
UniProtKB IDP01589
UniProtKB Entry NameIL2RA_HUMAN
GenBank Protein ID33813
GenBank Gene IDX01057
GenAtlas IDIL2RA
HGNC IDHGNC:6008
General References
  1. Nikaido T, Shimizu A, Ishida N, Sabe H, Teshigawara K, Maeda M, Uchiyama T, Yodoi J, Honjo T: Molecular cloning of cDNA encoding human interleukin-2 receptor. Nature. 1984 Oct 18-24;311(5987):631-5. [Article]
  2. Leonard WJ, Depper JM, Crabtree GR, Rudikoff S, Pumphrey J, Robb RJ, Kronke M, Svetlik PB, Peffer NJ, Waldmann TA, et al.: Molecular cloning and expression of cDNAs for the human interleukin-2 receptor. Nature. 1984 Oct 18-24;311(5987):626-31. [Article]
  3. Ishida N, Kanamori H, Noma T, Nikaido T, Sabe H, Suzuki N, Shimizu A, Honjo T: Molecular cloning and structure of the human interleukin 2 receptor gene. Nucleic Acids Res. 1985 Nov 11;13(21):7579-89. [Article]
  4. Leonard WJ, Depper JM, Kanehisa M, Kronke M, Peffer NJ, Svetlik PB, Sullivan M, Greene WC: Structure of the human interleukin-2 receptor gene. Science. 1985 Nov 8;230(4726):633-9. [Article]
  5. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [Article]
  6. Cross SL, Feinberg MB, Wolf JB, Holbrook NJ, Wong-Staal F, Leonard WJ: Regulation of the human interleukin-2 receptor alpha chain promoter: activation of a nonfunctional promoter by the transactivator gene of HTLV-I. Cell. 1987 Apr 10;49(1):47-56. [Article]
  7. Miedel MC, Hulmes JD, Weber DV, Bailon P, Pan YC: Structural analysis of recombinant soluble human interleukin-2 receptor. Primary structure, assignment of disulfide bonds and core IL-2 binding structure. Biochem Biophys Res Commun. 1988 Jul 15;154(1):372-9. [Article]
  8. Bamborough P, Hedgecock CJ, Richards WG: The interleukin-2 and interleukin-4 receptors studied by molecular modelling. Structure. 1994 Sep 15;2(9):839-51. [Article]
  9. Wang X, Rickert M, Garcia KC: Structure of the quaternary complex of interleukin-2 with its alpha, beta, and gammac receptors. Science. 2005 Nov 18;310(5751):1159-63. [Article]
  10. Stauber DJ, Debler EW, Horton PA, Smith KA, Wilson IA: Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Proc Natl Acad Sci U S A. 2006 Feb 21;103(8):2788-93. Epub 2006 Feb 13. [Article]
  11. Lowe CE, Cooper JD, Brusko T, Walker NM, Smyth DJ, Bailey R, Bourget K, Plagnol V, Field S, Atkinson M, Clayton DG, Wicker LS, Todd JA: Large-scale genetic fine mapping and genotype-phenotype associations implicate polymorphism in the IL2RA region in type 1 diabetes. Nat Genet. 2007 Sep;39(9):1074-82. Epub 2007 Aug 5. [Article]
  12. Goudy K, Aydin D, Barzaghi F, Gambineri E, Vignoli M, Ciullini Mannurita S, Doglioni C, Ponzoni M, Cicalese MP, Assanelli A, Tommasini A, Brigida I, Dellepiane RM, Martino S, Olek S, Aiuti A, Ciceri F, Roncarolo MG, Bacchetta R: Human IL2RA null mutation mediates immunodeficiency with lymphoproliferation and autoimmunity. Clin Immunol. 2013 Mar;146(3):248-61. doi: 10.1016/j.clim.2013.01.004. Epub 2013 Jan 24. [Article]
  13. Bezrodnik L, Caldirola MS, Seminario AG, Moreira I, Gaillard MI: Follicular bronchiolitis as phenotype associated with CD25 deficiency. Clin Exp Immunol. 2014 Feb;175(2):227-34. doi: 10.1111/cei.12214. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00004Denileukin diftitoxapproved, investigationalyesbinderDetails
DB00074Basiliximabapproved, investigationalyesantibodyDetails
DB00111Daclizumabinvestigational, withdrawnyesantibodyDetails
DB00041AldesleukinapprovedyesagonistmodulatorDetails
DB15628InolimomabinvestigationalunknownantibodyDetails
DB16411Camidanlumab tesirineinvestigationalunknownantibodyregulatorDetails