Alpha-1-acid glycoprotein 2
Details
- Name
- Alpha-1-acid glycoprotein 2
- Synonyms
- AGP 2
- AGP2
- OMD 2
- Orosomucoid-2
- Gene Name
- ORM2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0007040|Alpha-1-acid glycoprotein 2 MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQ EIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLL FLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKK DKCEPLEKQHEKERKQEEGES
- Number of residues
- 201
- Molecular Weight
- 23602.43
- Theoretical pI
- 4.76
- GO Classification
- Processesacute-phase response / regulation of immune system process / transportComponentsblood microparticle / extracellular exosome / extracellular space
- General Function
- Not Available
- Specific Function
- Functions as transport protein in the blood stream. Binds various hydrophobic ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
- Pfam Domain Function
- Lipocalin (PF00061)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0012546|Alpha-1-acid glycoprotein 2 (ORM2) ATGGCGCTGTCCTGGGTTCTTACAGTCCTGAGCCTCCTACCTCTGCTGGAAGCCCAGATC CCATTGTGTGCCAACCTAGTACCGGTGCCCATCACCAACGCCACCCTGGACCGGATCACT GGCAAGTGGTTTTATATCGCATCGGCCTTTCGAAACGAGGAGTACAATAAGTCGGTTCAG GAGATCCAAGCAACCTTCTTTTACTTTACCCCCAACAAGACAGAGGACACGATCTTTCTC AGAGAGTACCAGACCCGCCAGAACCAGTGCTTCTATAACTCCAGTTACCTGAATGTCCAG CGGGAGAATGGGACCGTCTCCAGATACGAGGGAGGCCGAGAACATGTTGCTCACCTGCTG TTCCTTAGGGACACCAAGACCTTGATGTTTGGTTCCTACCTGGACGATGAGAAGAACTGG GGGCTGTCTTTCTATGCTGACAAGCCAGAGACGACCAAGGAGCAACTGGGAGAGTTCTAC GAAGCTCTCGACTGCTTGTGCATTCCCAGGTCAGATGTCATGTACACCGACTGGAAAAAG GATAAGTGTGAGCCACTGGAGAAGCAGCACGAGAAGGAGAGGAAACAGGAGGAGGGGGAA TCCTAG
- Chromosome Location
- 9
- Locus
- 9q32
- External Identifiers
Resource Link UniProtKB ID P19652 UniProtKB Entry Name A1AG2_HUMAN GenBank Protein ID 16359000 GenBank Gene ID BC015964 HGNC ID HGNC:8499 - General References
- Dente L, Pizza MG, Metspalu A, Cortese R: Structure and expression of the genes coding for human alpha 1-acid glycoprotein. EMBO J. 1987 Aug;6(8):2289-96. [Article]
- Merritt CM, Board PG: Structure and characterisation of a duplicated human alpha 1 acid glycoprotein gene. Gene. 1988 Jun 15;66(1):97-106. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Schmid K, Burgi W, Collins JH, Nanno S: The disulfide bonds of alpha1-acid glycoprotein. Biochemistry. 1974 Jun 18;13(13):2694-7. [Article]
- Treuheit MJ, Costello CE, Halsall HB: Analysis of the five glycosylation sites of human alpha 1-acid glycoprotein. Biochem J. 1992 Apr 1;283 ( Pt 1):105-12. [Article]
- Hagglund P, Bunkenborg J, Elortza F, Jensen ON, Roepstorff P: A new strategy for identification of N-glycosylated proteins and unambiguous assignment of their glycosylation sites using HILIC enrichment and partial deglycosylation. J Proteome Res. 2004 May-Jun;3(3):556-66. [Article]
- Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
- Bunkenborg J, Pilch BJ, Podtelejnikov AV, Wisniewski JR: Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 2004 Feb;4(2):454-65. [Article]
- Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [Article]
- Halim A, Nilsson J, Ruetschi U, Hesse C, Larson G: Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Mol Cell Proteomics. 2012 Apr;11(4):M111.013649. doi: 10.1074/mcp.M111.013649. Epub 2011 Dec 14. [Article]
- Nishi K, Ono T, Nakamura T, Fukunaga N, Izumi M, Watanabe H, Suenaga A, Maruyama T, Yamagata Y, Curry S, Otagiri M: Structural insights into differences in drug-binding selectivity between two forms of human alpha1-acid glycoprotein genetic variants, the A and F1*S forms. J Biol Chem. 2011 Apr 22;286(16):14427-34. doi: 10.1074/jbc.M110.208926. Epub 2011 Feb 24. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01593 Zinc approved, investigational unknown Details DB00280 Disopyramide approved unknown Details DB00458 Imipramine approved unknown Details DB00281 Lidocaine approved, vet_approved unknown Details DB14487 Zinc acetate approved, investigational unknown Details DB14533 Zinc chloride approved, investigational unknown binder Details DB14548 Zinc sulfate, unspecified form approved, experimental unknown binder Details DB00477 Chlorpromazine approved, investigational, vet_approved unknown binder Details DB01041 Thalidomide approved, investigational, withdrawn yes binder Details DB09262 Imidafenacin investigational no substrate Details DB11828 Neratinib approved, investigational no substrate Details DB00512 Vancomycin approved no substrate Details DB12001 Abemaciclib approved, investigational unknown binder Details DB09053 Ibrutinib approved no substrate Details DB11641 Vinflunine approved, investigational no substrate Details DB14582 Patisiran approved, investigational unknown ligand Details DB00289 Atomoxetine approved no binder Details DB00332 Ipratropium approved, experimental no binder Details DB00404 Alprazolam approved, illicit, investigational unknown binder Details DB00421 Spironolactone approved unknown binder Details DB00476 Duloxetine approved unknown ligand Details DB00497 Oxycodone approved, illicit, investigational unknown binder Details DB00813 Fentanyl approved, illicit, investigational, vet_approved unknown binder Details DB01029 Irbesartan approved, investigational unknown binder Details DB01591 Solifenacin approved unknown binder Details DB00598 Labetalol approved unknown substrate Details DB01203 Nadolol approved unknown binder Details DB01611 Hydroxychloroquine approved unknown binder Details DB01045 Rifampicin approved unknown ligand Details DB11757 Istradefylline approved, investigational unknown binder Details DB01195 Flecainide approved, withdrawn unknown binder Details DB00278 Argatroban approved, investigational unknown binder Details DB06216 Asenapine approved unknown binder Details DB01072 Atazanavir approved, investigational no binder Details DB11703 Acalabrutinib approved, investigational unknown binder Details DB00857 Terbinafine approved, investigational, vet_approved unknown binder Details DB00950 Fexofenadine approved, investigational unknown substrate Details DB01115 Nifedipine approved unknown binder Details DB00938 Salmeterol approved unknown binder Details DB00608 Chloroquine approved, investigational, vet_approved unknown binder Details DB12466 Favipiravir approved, investigational unknown carrier Details DB00907 Cocaine approved, illicit unknown binder Details DB11689 Selumetinib approved, investigational unknown carrier Details DB14840 Ripretinib approved unknown binder Details DB00808 Indapamide approved unknown binder Details DB00409 Remoxipride approved, withdrawn unknown binder Details DB00960 Pindolol approved, investigational unknown binder Details DB01086 Benzocaine approved, investigational unknown binder Details DB00986 Glycopyrronium approved, investigational, vet_approved unknown binder Details DB08932 Macitentan approved no binder Details DB00342 Terfenadine approved, withdrawn unknown binderregulator Details DB00748 Carbinoxamine approved unknown binderregulator Details DB08865 Crizotinib approved, investigational unknown binder Details DB08930 Dolutegravir approved no binder Details DB12147 Erdafitinib approved, investigational no binder Details DB11978 Glasdegib approved, investigational no binder Details DB12005 Nirogacestat approved, investigational no binder Details