Erythropoietin

Identification

Summary

Erythropoietin is a recombinant form of human erythropoietin used to increase differentiation of progenitor cells to red blood cells in the treatment of anemia.

Brand Names

Abseamed, Epoetin Alfa Hexal, Epogen, Eporatio, Epprex, Eprex, Procrit, Retacrit, Silapo

Generic Name

Erythropoietin

DrugBank Accession Number

DB00016

Background

Erythropoietin (EPO) is a growth factor produced in the kidneys that stimulates the production of red blood cells. It works by promoting the division and differentiation of committed erythroid progenitors in the bone marrow ^Label. Epoetin alfa (Epoge) was developed by Amgen Inc. in 1983 as the first rhEPO commercialized in the United States, followed by other alfa and beta formulations. Epoetin alfa is a 165-amino acid erythropoiesis-stimulating glycoprotein produced in cell culture using recombinant DNA technology and is used for the treatment of patients with anemia associated with various clinical conditions, such as chronic renal failure, antiviral drug therapy, chemotherapy, or a high risk for perioperative blood loss from surgical procedures ^Label. It has a molecular weight of approximately 30,400 daltons and is produced by mammalian cells into which the human erythropoietin gene has been introduced. The product contains the identical amino acid sequence of isolated natural erythropoietin and has the same biological activity as the endogenous erythropoietin. Epoetin alfa biosimilar, such as Retacrit (epoetin alfa-epbx or epoetin zeta), has been formulated to allow more access to treatment options for patients in the market ⁵. The biosimilar is approved by the FDA and EMA as a safe, effective and affordable biological product and displays equivalent clinical efficacy, potency, and purity to the reference product ¹. Epoetin alfa formulations can be administered intravenously or subcutaneously.

Type

Biotech

Groups

Approved

Biologic Classification

Protein Based Therapies
Hormones

Protein Structure

Protein Chemical Formula: C₈₁₅H₁₃₁₇N₂₃₃O₂₄₁S₅
Protein Average Weight: 18396.1 Da

Sequences

>DB00016 (Erythropoietin) sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Download FASTA Format

Synonyms

E.P.O.
Epoetin alfa
Epoetin alfa rDNA
Epoetin alfa-epbx
Epoetin alfa, recombinant
Epoetin beta
Epoetin beta rDNA
Epoetin epsilon
Epoetin gamma
Epoetin gamma rDNA
Epoetin kappa
Epoetin omega
Epoetin theta
Epoetin zeta
Epoetina alfa
Epoetina beta
Epoetina dseta
Epoetina zeta
Epoétine zêta
Epoetinum zeta
Erythropoiesis stimulating factor
Erythropoietin (human, recombinant)
Erythropoietin (recombinant human)
ESF
SH-polypeptide-72

External IDs

BM 06.019

Poor quality drug data slowing you down?

Unlock 38% more drug discovery time and eliminate decision-making doubts with this one-stop guide to quality drug data.

Download eBook

Poor quality drug data slowing you down?

Download eBook

Pharmacology

Indication

Indicated in adult and paediatric patients for the:

treatment of anemia due to Chronic Kidney Disease (CKD) in patients on dialysis and not on dialysis.
treatment of anemia due to zidovudine in patients with HIV-infection.
treatment of anemia due to the effects of concomitant myelosuppressive chemotherapy, and upon initiation, there is a minimum of two additional months of planned chemotherapy.
reduction of allogeneic RBC transfusions in patients undergoing elective, noncardiac, nonvascular surgery.

Reduce drug development failure rates

Build, train, & validate machine-learning models
with evidence-based and structured datasets.

See how

Build, train, & validate predictive machine-learning models with structured datasets.

See how

Associated Conditions

Indication Type	Indication	Approval Level	Patient Characteristics	Dose Form
Treatment of	Anemia	••••••••••••	••• •••••••••• •••••• •• ••••••• ••••••••••••• ••••••••••• ••••••••••••	•••••••••
Treatment of	Anemia	••••••••••••		•••••••••
Treatment of	Anemia caused by zidovudine	••••••••••••		•••••••••
Prevention of	Surgical blood loss	••••••••••••	•••• •••• •• ••••• ••••	•••••••••
Prevention of	Surgical blood loss	••••••••••••	•••• •••• •• ••••• ••••	•••••••••

Contraindications & Blackbox Warnings

Prevent Adverse Drug Events Today

Tap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.

Learn more

Avoid life-threatening adverse drug events with our Clinical API

Learn more

Pharmacodynamics

Erythropoietin and epoetin alfa are involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. It is reported to increase the reticulocyte count within 10 days of initiation, followed by increases in the RBC count, hemoglobin, and hematocrit, usually within 2 to 6 weeks ⁷. Depending on the dose administered, the rate of hemoglobin increase may vary. In patients receiving hemodialysis, a greater biologic response is not observed at doses exceeding 300 Units/kg 3 times weekly ⁷.

Epoetin alfa serves to restore erythropoietin deficiency in pathological and other clinical conditions where normal production of erythropoietin is impaired or compromised. In anemic patients with chronic renal failure (CRF), administration with epoetin alfa stimulated erythropoiesis by increasing the reticulocyte count within 10 days, followed by increases in the red cell count, hemoglobin, and hematocrit, usually within 2 to 6 weeks ^Label. Epoetin alfa was shown to be effective in increasing hematocrit in zidovudine-treated HIV-infected patients and anemic cancer patients undergoing chemotherapy ^Label.

Mechanism of action

Erythropoietin or exogenous epoetin alfa binds to the erythropoietin receptor (EPO-R) and activates intracellular signal transduction pathways ³. The affinity (Kd) of EPO for its receptor on human cells is ∼100 to 200 pM ⁴. Upon binding to EPO-R on the surface of erythroid progenitor cells, a conformational change is induced which brings EPO-R-associated Janus family tyrosine protein kinase 2 (JAK2) molecules into close proximity. JAK2 molecules are subsequently activated via phosphorylation, then phosphorylate tyrosine residues in the cytoplasmic domain of the EPO-R that serve as docking sites for Src homology 2-domain-containing intracellular signaling proteins ³. The signalling proteins include STAT5 that once phosphorylated by JAK2, dissociates from the EPO-R, dimerizes, and translocates to the nucleus where they serve as transcription factors to activate target genes involved in cell division or differentiation, including the apoptosis inhibitor Bcl-x ³. The inhibition of apoptosis by the EPO-activated JAK2/STAT5/Bcl-x pathway is critical in erythroid differentiation. Via JAK2-mediated tyrosine phosphorylation, erythropoietin and epoetin alfa also activates other intracellular proteins involved in erythroid cell proliferation and survival, such as Shc , phosphatidylinositol 3-kinase (PI3K), and phospholipase C-γ1 ³.

Target	Actions	Organism
AErythropoietin receptor	agonist	Humans

Absorption

The time to reach peak concentration is slower via the subcutaneous route than the intravenous route which ranges from 20 to 25 hours, and the peak is always well below the peak achieved using the intravenous route (5–10% of those seen with IV administration).⁴ The bioavailability of subcutaneous injectable erythropoietin is much lower than that of the intravenously administered product and is approximately 20-40%.⁴

Adult and paediatric patients with CRF: Following subcutaneous administration, the peak plasma levels are achieved within 5 to 24 hours ^Label.

Cancer patients receiving cyclic chemotherapy: The average time to reach peak plasma concentration was approximately 13.3 ± 12.4 hours after 150 Units/kg three times per week (TIW) subcutaneous (SC) dosing. The Cmax is expected be 3- to 7- fold higher and the Tmax is expected to be 2- to 3-fold longer in patients receiving a 40,000 Units SC weekly dosing regimen ^Label.

Volume of distribution

In healthy volunteers, the volume of distribution of intravenous epoetin alfa was generally similar to the plasma volume (range of 40–63.80 mL/kg), indicating limited extravascular distribution ^4,2.

Protein binding

No information of serum protein binding available.

Metabolism

Binding of erythropoietin and epoetin alfa to EPO-R leads to cellular internalization, which involves the degradation of the ligand. Erythropoietin and epoetin alfa may also be degraded by the reticuloendothelial scavenging pathway or lymphatic system ⁴.

Route of elimination

Erythropoietin and epoetin alfa are cleared via uptake and degradation via the EPO-R-expressing cells, and may also involve other cellular pathways in the interstitium, probably via cells in the reticuloendothelial scavenging pathway or lymphatic system ⁴. Only a small amount of unchanged epoetin alfa is found in the urine ⁸.

Half-life

Healthy volunteers: The half life is approximately 4 hours in healthy volunteers receiving an intravenous injection ⁷. A half-life of approximately 6 hours has been reported in children ⁷.

Adult and paediatric patients with CRF: The elimination half life following intravenous administration ranges from 4 to 13 hours, which is about 20% longer in CRF patients than that in healthy subjects. The half life is reported to be similar between adult patients receiving or not receiving dialysis ^Label.

Cancer patients receiving cyclic chemotherapy: Following subcutaneous administration, the average half life is 40 hours with range of 16 to 67 hours ^Label.

Clearance

*Healthy volunteers: * In male volunteers receiving intravenous epoetin alfa, the total body clearance was approximately 8.12 ± 1.00 mL/h/kg ².

Cancer patients receiving cyclic chemotherapy: The average clearance was approximately 20.2 ± 15.9 mL/h/kg after 150 Units/kg three times per week (TIW) subcutaneous (SC) dosing ^Label. The patients receiving a 40,000 Units SC weekly dosing regimen display a lower clearance (9.2 ± 4.7 mL/h/kg) ^Label.

Adverse Effects

Improve decision support & research outcomes

With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!

See the data

Improve decision support & research outcomes with our structured adverse effects data.

See a data sample

Toxicity

Overdose from epoetin alfa include signs and symptoms associated with an excessive and/or rapid increase in hemoglobin concentration, including cardiovascular events. Patients with suspected or known overdose should be monitored closely for cardiovascular events and hematologic abnormalities. Polycythemia should be managed acutely with phlebotomy, as clinically indicated. Following resolution of the overdose, reintroduction of epoetin alfa therapy should be accompanied by close monitoring for evidence of rapid increases in hemoglobin concentration (>1 gm/dL per 14 days). In patients with an excessive hematopoietic response, reduce the dose in accordance with the recommendations described in the drug label ^Label.

Pathways

Not Available

Pharmacogenomic Effects/ADRs

Not Available

Interactions

Drug Interactions

This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.

Drug	Interaction
Integrate drug-drug interactions in your software
Abemaciclib	The risk or severity of Thrombosis can be increased when Erythropoietin is combined with Abemaciclib.
Abiraterone	The risk or severity of Thrombosis can be increased when Erythropoietin is combined with Abiraterone.
Adagrasib	The risk or severity of Thrombosis can be increased when Erythropoietin is combined with Adagrasib.
Afatinib	The risk or severity of Thrombosis can be increased when Erythropoietin is combined with Afatinib.
Aldesleukin	The risk or severity of Thrombosis can be increased when Erythropoietin is combined with Aldesleukin.

Food Interactions

Administer iron supplement. When initiating an erythropoiesis-stimulating agent, evaluate iron stores and start iron supplementation if indicated. Most patients with chronic kidney disease require iron supplementation while taking an erythropoiesis-stimulating agent.

Products

Drug product information from 10+ global regions

Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.

Access now

Access drug product information from over 10 global regions.

Access now

International/Other Brands

Epobel (Nobel Ilac Pazarlama ve Sanayii Ltd. STI., Turkey) / Epocept (Lupin pharma) / Epofit (Intas pharma) / Epogin (Chugai) / Eqralys (Hemofarm AD) / Nanokine (Nanogen Pharmaceutical biotechnology, Vietnam))

Brand Name Prescription Products

Name	Dosage	Strength	Route	Labeller	Marketing Start	Marketing End
Abseamed	Injection, solution	9000 IU/0.9ml	Intravenous; Subcutaneous	Medice Arzneimittel Pütter Gmb H Co. Kg	2016-09-07	Not applicable
Abseamed	Injection, solution	8000 IU/0.8ml	Intravenous; Subcutaneous	Medice Arzneimittel Pütter Gmb H Co. Kg	2016-09-07	Not applicable
Abseamed	Injection, solution	30000 IU/0.75ml	Intravenous; Subcutaneous	Medice Arzneimittel Pütter Gmb H Co. Kg	2016-09-07	Not applicable
Abseamed	Injection, solution	8000 IU/0.8ml	Intravenous; Subcutaneous	Medice Arzneimittel Pütter Gmb H Co. Kg	2016-09-07	Not applicable
Abseamed	Injection, solution	5000 IU/0.5ml	Intravenous; Subcutaneous	Medice Arzneimittel Pütter Gmb H Co. Kg	2016-09-07	Not applicable

Chemical Identifiers

UNII: 64FS3BFH5W
CAS number: 11096-26-7

References

General References

Brinks V, Hawe A, Basmeleh AH, Joachin-Rodriguez L, Haselberg R, Somsen GW, Jiskoot W, Schellekens H: Quality of original and biosimilar epoetin products. Pharm Res. 2011 Feb;28(2):386-93. doi: 10.1007/s11095-010-0288-2. Epub 2010 Oct 1. [Article]
Halstenson CE, Macres M, Katz SA, Schnieders JR, Watanabe M, Sobota JT, Abraham PA: Comparative pharmacokinetics and pharmacodynamics of epoetin alfa and epoetin beta. Clin Pharmacol Ther. 1991 Dec;50(6):702-12. [Article]
Weiss MJ: New insights into erythropoietin and epoetin alfa: mechanisms of action, target tissues, and clinical applications. Oncologist. 2003;8 Suppl 3:18-29. [Article]
Elliott S, Pham E, Macdougall IC: Erythropoietins: a common mechanism of action. Exp Hematol. 2008 Dec;36(12):1573-84. doi: 10.1016/j.exphem.2008.08.003. Epub 2008 Oct 14. [Article]
FDA News Release: FDA approves first epoetin alfa biosimilar for the treatment of anemia [Link]
Linus Pauling Institute Micronutrient Information Center: Vitamin E [Link]
EMA Summary of Product Characteristics: RETACRIT (epoetin alfa-epox) injection, for intravenous or subcutaneous use [File]
Epoetin Alfa (Epogen®) Product Monograph [File]

External Links

UniProt: P01588
Genbank: X02158
PubChem Substance: 46508122
RxNav: 105694
ChEMBL: CHEMBL1201565
Therapeutic Targets Database: DAP000202
PharmGKB: PA10072
RxList: RxList Drug Page
Drugs.com: Drugs.com Drug Page
Wikipedia: Epoetin_alfa

FDA label

Download (725 KB)

Clinical Trials

Clinical Trials

Phase	Status	Purpose	Conditions	Count
4	Completed	Basic Science	Hypertension / Thrombosis	1
4	Completed	Basic Science	Other and unspecified effects of high altitude	1
4	Completed	Basic Science	Renal Anemia	1
4	Completed	Diagnostic	Anemia / Renal Failure, Chronic Renal Failure	1
4	Completed	Prevention	Diabetic Nephropathy	1

Pharmacoeconomics

Manufacturers

Not Available

Packagers

Amgen Inc.
Centocor Ortho Biotech Inc.
DSM Corp.
Janssen-Ortho Inc.
JHP Pharmaceuticals LLC
Ortho-McNeil-Janssen Pharmaceuticals Inc.
Physicians Total Care Inc.

Dosage Forms

Form	Route	Strength
Injection, solution	Intravenous	1000 UI/0.5ML
Injection, solution	Intravenous	10000 UI/1.0ML
Injection, solution	Intravenous	3000 UI/0.3ML
Injection, solution	Intravenous	4000 UI/0.4ML
Injection, solution	Intravenous	5000 UI/0.5ML
Injection, solution	Intravenous	6000 UI/0.6ML
Injection, solution	Intravenous	8000 UI/0.8ML
Solution	Intravenous	1000 UI/0.5ML
Solution	Intravenous	2000 UI/1.0ML
Solution	Intravenous	3000 UI/0.3ML
Injection, solution	Parenteral	10000 I.E./1ML
Injection, solution	Parenteral	1000 I.E./0.5ML
Injection, solution	Parenteral	2000 I.E./1ML
Injection, solution	Parenteral	3000 I.E./0.3ML
Injection, solution	Parenteral	4000 I.E./0.4ML
Injection, solution	Parenteral	5000 I.E./0.5ML
Injection, solution	Parenteral	6000 I.E./0.6ML
Injection, solution	Parenteral	8000 I.E./0.8ML
Injection, solution		4000 IU/ml
Injection, solution	Intravenous	20000 UI/0.5ML
Injection, solution	Intravenous	30000 UI/0.75ML
Injection, solution	Intravenous	40000 UI/1.0ML
Injection, solution	Intravenous; Subcutaneous	2000 IU/1.0ML
Injection, solution	Intravenous; Subcutaneous	20000 IU/0.5ML
Injection, solution	Intravenous; Subcutaneous	3000 IU/3.0ML
Injection, solution	Intravenous; Subcutaneous	30000 IU/0.75ML
Injection, solution	Intravenous; Subcutaneous	40000 IU/1ML
Injection, solution	Intravenous; Subcutaneous	40000 IU/1.0ML
Injection, solution	Subcutaneous	7000 UI/0.7ML
Injection, solution	Subcutaneous	9000 UI/0.9ML
Solution	Intravenous; Parenteral	1000 UI/0.5ML
Solution	Intravenous; Parenteral	10000 UI/1ML
Solution	Intravenous; Parenteral	2000 UI/1ML
Solution	Intravenous; Parenteral	20000 UI/0.5ML
Solution	Intravenous; Parenteral	3000 UI/0.3ML
Solution	Intravenous; Parenteral	30000 UI/0.75ML
Solution	Intravenous; Parenteral	4000 UI/0.4ML
Solution	Intravenous; Parenteral	40000 UI/1ML
Solution	Intravenous; Parenteral	5000 UI/0.5ML
Solution	Intravenous; Parenteral	6000 UI/0.6ML
Solution	Intravenous; Parenteral	7000 UI/0.7ML
Solution	Intravenous; Parenteral	8000 UI/0.8ML
Solution	Intravenous; Parenteral	9000 UI/0.9ML
Injection, solution	Parenteral	10.000 I.E./1ML
Injection, solution	Intravenous; Subcutaneous	10000 iu/1ml
Solution	Intravenous; Subcutaneous
Injection, solution	Parenteral	2.000 I.E./1.0ML
Injection, solution	Parenteral	2.000 I.E./1ML
Injection, solution	Parenteral	2.000 IE/1ML
Injection, solution	Intravenous; Subcutaneous	2000 iu/1ml
Injection, solution	Parenteral	2000 IE/1ML
Injection, solution	Parenteral	3.000 I.E./0.3ML
Injection, solution	Parenteral	3000 IE/0.3ML
Injection, solution	Parenteral	4.000 I.E./0.4ML
Injection, solution	Parenteral	40.000 I.E./1ML
Injection, solution	Parenteral	40.000 IE/1ML
Injection, solution	Parenteral	40000 I.E./1ML
Injection, solution	Parenteral	5.000 I.E./0.5ML
Injection, solution	Parenteral	6.000 I.E./0.6ML
Injection, solution	Parenteral	8.000 I.E./0.8ML
Injection, solution	Intravenous	2000 iu/0.2ml
Injection, solution	Intravenous	3000 iu/0.3ml
Injection, solution	Intravenous	4000 iu/0.4ml
Injection, solution		10000 iu/1ml
Solution	Intravenous; Subcutaneous	10000 IU/ml
Solution	Intravenous; Subcutaneous	2000 IU/0.6ml
Injection, solution		3333 iu/1ml
Injection, solution		40000 iu/1ml
Solution	Intravenous; Subcutaneous	4000 IU/0.4ml
Injection	Intravenous	10000 iu/1.0ml
Injection	Intravenous	1000 iu/0.3ml
Injection	Intravenous	2000 iu/0.6ml
Injection	Intravenous	3000 iu/0.9ml
Injection	Intravenous	4000 iu/0.4ml
Injection	Intravenous	5000 iu/0.5ml
Injection	Intravenous	6000 iu/0.6ml
Injection	Intravenous	8000 iu/0.8ml
Injection, solution	Parenteral	10000 IE
Injection, solution	Parenteral	1000 IE
Injection, solution	Parenteral	20000 IE
Injection, solution	Parenteral	2000 IE
Injection, solution	Parenteral	30000 IE
Injection, solution	Parenteral	3000 IE
Injection, solution	Parenteral	40000 IE
Injection, solution	Parenteral	4000 IE
Injection, solution	Parenteral	5000 IE
Injection, solution	Parenteral	6000 IE
Injection, solution	Parenteral	8000 IE
Solution	Intravenous; Subcutaneous	10000 [iU]/1mL
Solution	Intravenous; Subcutaneous	2000 [iU]/1mL
Solution	Intravenous; Subcutaneous	20000 [iU]/1mL
Solution	Intravenous; Subcutaneous	3000 [iU]/1mL
Solution	Intravenous; Subcutaneous	4000 [iU]/1mL
Solution	Intravenous; Subcutaneous	40000 1/1mL
Injection, solution	Intravenous	2000 iu/ml
Injection, solution	Intravenous	4000 iu/ml
Injection, solution	Intravenous; Parenteral	10000 UI/1.0ML
Injection, solution	Intravenous; Parenteral	20000 UI/1.0ML
Injection, solution	Intravenous; Parenteral	30000 UI/1.0ML
Injection, solution	Intravenous; Subcutaneous	10000 IU/1.0ML
Injection, solution	Intravenous; Subcutaneous	2000 IU/0.5ML
Injection, solution	Intravenous; Subcutaneous	20000 IU/1.0ML
Injection, solution	Intravenous; Subcutaneous	3000 IU/0.5ML
Injection, solution	Intravenous; Subcutaneous	30000 IU/1.0ML
Injection, solution	Intravenous; Subcutaneous	4000 IU/0.5ML
Injection, solution	Intravenous; Subcutaneous	5000 IU/0.5ML
Solution	Subcutaneous	8.300 mcg
Injection, solution	Parenteral	1000 IE/0.5ML
Injection, solution	Parenteral	1.0 ML
Injection, solution	Parenteral	10000 IE/1.0ML
Injection, solution	Parenteral	2000 IE/0.5ML
Injection, solution	Parenteral	1 ML
Injection, solution	Parenteral	20000 IE/1.0ML
Injection, solution	Parenteral	20000 IE/1ML
Injection, solution	Parenteral	30.000 IE/1.0ML
Injection, solution	Parenteral	3000 IE/0.5ML
Injection, solution	Parenteral	30000 IE/1.0ML
Injection, solution	Parenteral	30000 IE/1ML
Injection, solution	Parenteral	4000 IE/0.5ML
Injection, solution	Parenteral	0.5 ML
Injection	Intravenous; Subcutaneous	10000 iu/1.0ml
Solution		4000 iu/0.4ml
Injection		10000 IU
Injection		2000 IU/0.5ml
Injection		4000 IU
Injection, solution
Injection, solution	Intravenous; Subcutaneous
Injection, powder, lyophilized, for solution	Intravenous; Subcutaneous	1000 IU
Injection, solution		30000 UI/0.75ML
Injection, solution		40000 UI
Injection, solution		40000 UI/ML
Injection, solution	Intravenous; Subcutaneous	1000 IU/0.5ml
Injection, solution	Intravenous; Subcutaneous	10000 IU/ml
Injection, solution	Intravenous; Subcutaneous	2000 IU/ml
Injection, solution	Intravenous; Subcutaneous	3000 IU/0.3ml
Injection, solution	Intravenous; Subcutaneous	4000 IU/ml
Injection, solution	Intravenous; Subcutaneous	4000 IU/0.4ml
Injection, solution	Intravenous; Subcutaneous	500 IU/0.25ml
Injection, solution	Intravenous; Subcutaneous	6000 IU/0.6ml
Injection, solution	Intravenous; Subcutaneous	7000 IU/0.7ml
Injection, solution	Intravenous; Subcutaneous	8000 IU/0.8ml
Injection, solution	Intravenous; Subcutaneous	9000 IU/0.9ml
Injection, solution	Parenteral	40000 IU/ML
Solution		2000 iu/0.5ml
Solution		40000 IU/1ml
Injection	Subcutaneous	10000 iu/ml
Injection	Subcutaneous	2000 iu/0.5ml
Injection	Intravenous; Subcutaneous	3000 iu/0.3ml
Injection	Subcutaneous	4000 iu/0.4ml
Injection	Intravenous; Subcutaneous	40000 iu/ml
Injection	Intravenous; Subcutaneous	6000 iu/0.6ml
Injection	Intravenous; Subcutaneous	10000 IU/ML
Injection	Intravenous; Subcutaneous	2000 IU/0.5ml
Injection	Intravenous; Subcutaneous	4000 IU/0.4ml
Solution	Intravenous; Subcutaneous	20000 unit / 0.5 mL
Solution	Intravenous; Subcutaneous	30000 unit / 0.75 mL
Solution	Intravenous; Subcutaneous	10000 unit / mL
Solution	Intravenous; Subcutaneous	1000 unit / 0.5 mL
Solution	Intravenous; Subcutaneous	20000 unit / mL
Solution	Intravenous; Subcutaneous	2000 unit / 0.5 mL
Solution	Intravenous; Subcutaneous	2000 unit / mL
Solution	Intravenous; Subcutaneous	3000 unit / 0.3 mL
Solution	Intravenous; Subcutaneous	40000 unit / mL
Solution	Intravenous; Subcutaneous	4000 unit / 0.4 mL
Solution	Intravenous; Subcutaneous	4000 unit / mL
Solution	Intravenous; Subcutaneous	5000 unit / 0.5 mL
Solution	Intravenous; Subcutaneous	6000 unit / 0.6 mL
Solution	Intravenous; Subcutaneous	8000 unit / 0.8 mL
Solution	Intravenous; Subcutaneous	10000 IU
Solution	Intravenous; Subcutaneous	2000 IU
Solution	Intravenous; Subcutaneous	40000 IU
Injection, powder, lyophilized, for solution	Intravenous; Subcutaneous	2000 IU
Injection, powder, lyophilized, for solution	Intravenous; Subcutaneous	4000 IU
Solution	Intravenous; Subcutaneous	4000 IU
Solution	Parenteral	2000 IU
Solution	Parenteral	1000 UI
Injection	Parenteral
Injection, solution	Parenteral	1000 IU
Injection, solution	Parenteral	10000 IU
Injection, solution	Parenteral	2000 IU
Injection, solution	Parenteral	20000 I.E./0.5ML
Injection, solution	Parenteral	3000 IU
Injection, solution	Parenteral	30000 I.E./0.75ML
Injection, solution	Parenteral	4000 IU
Injection, solution	Parenteral	40000 I.E./ML
Injection, solution	Parenteral	5000 IU
Injection, solution	Parenteral	6000 IU
Injection, solution	Parenteral	8000 IU
Injection	Intravenous
Solution		4000 iu/1ml
Solution	Parenteral	2000 UI
Injection, solution		1000 IU/0.25ml
Injection, powder, for solution		1000 IU
Injection, powder, for solution		10000 IU
Injection, powder, for solution		2000 IU
Injection, powder, for solution		3000 IU
Injection, powder, for solution	Intravenous; Subcutaneous	50000 IU
Injection, solution	Intravenous; Parenteral	1000 IU/0.3ML
Injection, solution	Intravenous; Parenteral	10000 IU/0.6ML
Injection, solution	Intravenous; Parenteral	10000 IU
Injection, solution	Intravenous; Parenteral	2000 IU/0.3ML
Injection, solution	Intravenous; Parenteral	20000 IU/0.6ML
Injection, solution	Intravenous; Parenteral	3000 IU/0.3ML
Injection, solution	Intravenous; Parenteral	4000 IU/0.3ML
Injection, solution	Intravenous; Parenteral	500 IU/0.3ML
Injection, solution	Intravenous; Parenteral	5000 IU/0.3ML
Injection, solution	Intravenous; Parenteral	6000 IU/0.3ML
Injection, solution	Intravenous; Parenteral; Subcutaneous	2000 IU/0.3ML
Injection, solution	Intravenous; Subcutaneous	10000 IU
Injection, solution	Intravenous; Subcutaneous	2000 IU
Injection, solution	Intravenous; Subcutaneous	20000 IU
Injection, solution	Intravenous; Subcutaneous	3000 IU
Injection, solution	Intravenous; Subcutaneous	30000 IU
Injection, solution	Intravenous; Subcutaneous	4000 IU
Injection, solution	Intravenous; Subcutaneous	500 IU
Injection, solution	Intravenous; Subcutaneous	5000 IU
Injection, solution	Intravenous; Subcutaneous	6000 IU
Injection, solution	Parenteral; Subcutaneous	4000 IU
Injection, solution	Parenteral; Subcutaneous	6000 IU
Powder	Intravenous	1000 UI
Powder	Intravenous	10000 UI
Powder	Intravenous	2000 UI
Powder	Intravenous	500 UI
Powder	Intravenous	5000 UI
Powder	Parenteral	100000 IU/ml
Powder	Parenteral	50000 IU/ml
Powder	Subcutaneous	10000 UI
Powder	Subcutaneous	20000 UI
Injection, solution	Parenteral	10.000 I.E.
Injection, solution	Intravenous; Subcutaneous	10000 iu/0.6ml
Injection, solution	Parenteral	10000 IU/0.6ml
Injection, solution	Intravenous; Subcutaneous	2000 iu/0.3ml
Injection, solution	Intravenous; Subcutaneous	20000 iu/0.6ml
Injection, solution	Parenteral	2000 IU/0.3ml
Injection, solution	Parenteral	3000 IU/0.3ml
Injection, solution	Parenteral	4000 IU/0.3ml
Injection, solution	Parenteral	5000 IU/0.3ml
Injection, solution	Intravenous; Subcutaneous	5000 iu/0.3ml
Injection, solution	Parenteral	500 IU/0.3ml
Injection, solution	Parenteral	6000 IU/0.3ml
Injection, solution	Intravenous; Subcutaneous	10000 [iU]/1mL
Injection, solution	Intravenous; Subcutaneous	2000 [iU]/1mL
Injection, solution	Intravenous; Subcutaneous	20000 [iU]/1mL
Injection, solution	Intravenous; Subcutaneous	3000 [iU]/1mL
Injection, solution	Intravenous; Subcutaneous	4000 [iU]/1mL
Injection, solution	Intravenous; Subcutaneous	40000 [iU]/1mL
Injection		2000 IU
Injection		5000 IU
Injection, solution		2000 IU/0.3ml
Injection, solution		3000 IU/0.3ml
Injection, solution		5000 IU/0.3ml
Injection	Intravenous; Subcutaneous	10000 iu/0.6ml
Injection	Intravenous; Subcutaneous	2000 iu/0.3ml
Injection, solution	Intravenous; Subcutaneous	30000 IU/0.6ml
Injection	Intravenous; Subcutaneous	4000 iu/0.3ml
Injection	Intravenous; Subcutaneous
Solution	Parenteral	1000 IU
Solution	Intravenous; Subcutaneous	500 IU
Solution	Intravenous; Subcutaneous	5000 IU
Solution		3000 IU/0.3ml
Solution	Intravenous; Subcutaneous	30000 IU
Injection
Injection		10000 IU/ml
Injection		2000 IU/ml
Injection		3000 IU/ml
Injection		4000 IU/ml
Injection, solution	Intravenous; Parenteral	1000 UI/0.3ML
Injection, solution	Intravenous; Parenteral	10000 IU/1.0ML
Injection, solution	Intravenous; Parenteral	2000 IU/0.6ML
Injection, solution	Intravenous; Parenteral	2000 UI/0.6ML
Injection, solution	Intravenous; Parenteral	20000 UI/0.5ML
Injection, solution	Intravenous; Parenteral	20000 IU/0.5ML
Injection, solution	Intravenous; Parenteral	3000 IU/0.9ML
Injection, solution	Intravenous; Parenteral	3000 UI/0.9ML
Injection, solution	Intravenous; Parenteral	30000 IU/0.75ML
Injection, solution	Intravenous; Parenteral	30000 UI/0.75ML
Injection, solution	Intravenous; Parenteral	4000 IU/0.4ML
Injection, solution	Intravenous; Parenteral	4000 UI/0.4ML
Injection, solution	Intravenous; Parenteral	40000 IU/1.0ML
Injection, solution	Intravenous; Parenteral	40000 UI/1.0ML
Injection, solution	Intravenous; Parenteral	5000 UI/0.5ML
Injection, solution	Intravenous; Parenteral	5000 IU/0.5ML
Injection, solution	Intravenous; Parenteral	6000 IU/0.6ML
Injection, solution	Intravenous; Parenteral	6000 UI/0.6ML
Injection, solution	Intravenous; Parenteral	8000 IU/0.8ML
Injection, solution	Intravenous; Parenteral	8000 UI/0.8ML
Injection, solution	Intravenous; Subcutaneous	1000 IU/0.3ML
Injection, solution	Intravenous; Subcutaneous	2000 IU/0.6ML
Injection, solution	Intravenous; Subcutaneous	3000 IU/0.9ML
Injection, solution	Parenteral	10.000 I.E./1.0ML
Injection, solution	Parenteral	10000 I.E./1.0ML
Injection, solution	Parenteral	1000 I.E./0.3ML
Injection, solution	Parenteral	1000 IE/0.3ML
Injection, solution	Parenteral	2.000 I.E./0.6ML
Injection, solution	Parenteral	2000 I.E./0.6ML
Injection, solution	Parenteral	20000 IE/0.5ML
Injection, solution	Parenteral	2000 IE/0.6ML
Injection, solution	Parenteral	3.000 I.E./0.9ML
Injection, solution	Parenteral	30.000 IE/0.75ML
Injection, solution	Parenteral	3000 I.E./0.9ML
Injection, solution	Parenteral	30000 IE/0.75ML
Injection, solution	Parenteral	3000 IE/0.9ML
Injection, solution	Parenteral	4.000 IE/0.4ML
Injection, solution	Parenteral	40.000 I.E./1.0ML
Injection, solution	Parenteral	40000 I.E./1.0ML
Injection, solution	Parenteral	40000 IE/1.0ML
Injection, solution	Parenteral	4000 IE/0.4ML
Injection, solution	Parenteral	5000 IE/0.5ML
Injection, solution	Parenteral	6.000 IE/0.6ML
Injection, solution	Parenteral	6000 IE/0.6ML
Injection, solution	Parenteral	8000 IE/0.8ML
Injection, solution		4000 IU/1ml
Solution		10000 IU/0.6ml
Solution		2000 IU/0.3ml
Solution		30000 IU/0.6ml
Solution		5000 IU/0.3ml
Injection, solution		2000 iu/0.5ml
Solution		10000 iu/1ml
Solution		2000 iu/1ml
Injection, solution		4000 iu/0.4ml
Injection, solution		5000 IU/0.5ml
Injection, powder, for solution		4000 IU

Prices

Unit description	Cost	Unit
Epogen 40000 unit/ml Solution 1 Box Contains Ten 1ml Vials	6852.3USD	box
Epogen 20000 unit/ml Solution 1 Box Contains Ten 1ml Vials	3157.44USD	box
Epogen 10000 unit/ml Solution 1 Box Contains Ten 1ml Vials	1578.72USD	box
Procrit 40000 unit/ml vial	767.03USD	vial
Procrit 10000 unit/ml vial	710.87USD	vial
Epogen 40000 unit/ml vial	640.37USD	ml
Procrit 20000 unit/ml vial	388.97USD	ml
Procrit 20000 unit/ml Solution	378.14USD	ml
Procrit 10000 unit/ml Solution 2ml Vial	358.02USD	vial
Epogen 10000 unit/ml Solution 2ml Vial	315.74USD	vial
Epogen 20000 unit/ml vial	303.6USD	ml
Epogen 10000 unit/ml vial	151.8USD	ml
Procrit 4000 unit/ml vial	74.17USD	vial
Epogen 4000 unit/ml vial	61.34USD	vial
Procrit 3000 unit/ml vial	55.63USD	vial
Epogen 3000 unit/ml vial	47.53USD	vial
Procrit 2000 unit/ml vial	37.09USD	vial
Epogen 2000 unit/ml vial	34.14USD	vial

DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.

Patents

Patent Number	Pediatric Extension	Approved	Expires (estimated)	Region
CA1339047	No	1997-05-27	2014-05-27

Properties

State

Liquid

Experimental Properties

Property	Value	Source
melting point (°C)	53 °C	Arakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
isoelectric point	8.75	Not Available

Targets

Build, predict & validate machine-learning models

Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.

Learn more

Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.

Learn more

Details1. Erythropoietin receptor

Kind: Protein
Organism: Humans
Pharmacological action: Yes
Actions: Agonist

General Function: Identical protein binding
Specific Function: Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In som...
Gene Name: EPOR
Uniprot ID: P19235
Uniprot Name: Erythropoietin receptor
Molecular Weight: 55064.725 Da

References

LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. [Article]
Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. [Article]
Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]

Drug created at June 13, 2005 13:24 / Updated at February 19, 2024 14:22

Erythropoietin

Identification

Pharmacology

Interactions

Products

Categories

Chemical Identifiers

References

Clinical Trials

Pharmacoeconomics

Properties

Targets

References