Denileukin diftitox
Identification
- Summary
Denileukin diftitox is a recombinant cytotoxic protein based on a combination of diphtheria toxin fragments and interleukin-2 used to treat cutaneous T-cell lymphoma by targeting the interleukin-2 receptor.
- Generic Name
- Denileukin diftitox
- DrugBank Accession Number
- DB00004
- Background
A recombinant DNA-derived cytotoxic protein composed of the amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His followed by the sequences for interleukin-2 (IL-2; Ala 1-Thr 133). It is produced in an E. coli expression system.
- Type
- Biotech
- Groups
- Approved, Investigational
- Biologic Classification
- Protein Based Therapies
Interleukin-based products / Fusion proteins - Protein Structure
- Protein Chemical Formula
- C2560H4042N678O799S17
- Protein Average Weight
- 57647.3 Da
- Sequences
>DB00004 sequence MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNK YDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVG TEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMY EYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVS EEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEK TTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYN FVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYK NPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVI VLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT
Download FASTA Format- Synonyms
- Denileukin
- Denileukin diftitox
- Interleukin-2/diptheria toxin fusion protein
- External IDs
- DAB-389IL2
- DAB389 IL2
- DAB389IL2
- LY-335348
- LY335348
Pharmacology
- Indication
For treatment of cutaneous T-cell lymphoma
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Treatment of Cutaneous t-cell lymphoma •••••••••••• ••••• ••••••••• - Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
Denileukin diftitox (Ontak) directs the cytocidal action of diphtheria toxin to cells which express the IL-2 receptor. The human IL-2 receptor exists in three forms, low (CD25), intermediate (CD122/CD132) and high (CD25/CD122/CD132) affinity. Malignant cells expressing one or more of the subunits of the IL-2 receptor are found in certain leukemias and lymphomas including cutaneous T-cell lymphoma (CTCL). Ontak interacts with the high affinity IL-2 receptor on the cell surface and inhibits cellular protein synthesis, resulting in cell death within hours.
- Mechanism of action
Denileukin diftitox binds to the high-affinity IL-2 receptor complex. The IL-2 receptor (Tac) subunit is expressed on activated but not resting lymphocytes. The diphtheria toxin associated with Ontak then selectively kills the IL-2 bearing cells.
Target Actions Organism AInterleukin-2 receptor subunit alpha binderHumans AInterleukin-2 receptor subunit beta agonistHumans UCytokine receptor common subunit gamma Not Available Humans - Absorption
Not Available
- Volume of distribution
- 0.06 to 0.09 L/kg
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
70-80 min
- Clearance
- 0.6 - 2.0 mL/min/kg [Lymphoma]
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAmbroxol The risk or severity of methemoglobinemia can be increased when Denileukin diftitox is combined with Ambroxol. Articaine The risk or severity of methemoglobinemia can be increased when Denileukin diftitox is combined with Articaine. Benzocaine The risk or severity of methemoglobinemia can be increased when Denileukin diftitox is combined with Benzocaine. Benzyl alcohol The risk or severity of methemoglobinemia can be increased when Denileukin diftitox is combined with Benzyl alcohol. Bupivacaine The risk or severity of methemoglobinemia can be increased when Denileukin diftitox is combined with Bupivacaine. - Food Interactions
- Not Available
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Ontak Injection, solution 150 ug/1mL Intravenous Eisai Limited 2013-11-01 2013-11-01 US
Categories
- ATC Codes
- L01XX29 — Denileukin diftitox
- Drug Categories
- ADP Ribose Transferases
- Amino Acids, Peptides, and Proteins
- Antineoplastic Agents
- Antineoplastic and Immunomodulating Agents
- Bacterial Toxins
- Biological Factors
- Cancer immunotherapy
- CD25-directed Cytotoxin
- Cytokines
- Enzymes
- Enzymes and Coenzymes
- Glycosyltransferases
- Immunotherapy
- Intercellular Signaling Peptides and Proteins
- Interleukins
- Lymphokines
- Narrow Therapeutic Index Drugs
- Pentosyltransferases
- Peptides
- Proteins
- Recombinant Proteins
- Toxins, Biological
- Transferases
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans and other mammals
Chemical Identifiers
- UNII
- 25E79B5CTM
- CAS number
- 173146-27-5
References
- General References
- Turturro F: Denileukin diftitox: a biotherapeutic paradigm shift in the treatment of lymphoid-derived disorders. Expert Rev Anticancer Ther. 2007 Jan;7(1):11-7. [Article]
- Park M, Liu GT, Piltz-Seymour J, Wisda CL, Rook AH, Junkins-Hopkins JM, Nasta SD, Kim EJ: Vision loss following denileukin diftitox treatment: a case report of possible posterior ischemic optic neuropathy. Leuk Lymphoma. 2007 Apr;48(4):808-11. [Article]
- External Links
- UniProt
- P00587
- Genbank
- V01536
- PubChem Substance
- 46506950
- 214470
- ChEMBL
- CHEMBL1201550
- Therapeutic Targets Database
- DAP001098
- PharmGKB
- PA164750594
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Denileukin_diftitox
- FDA label
- Download (434 KB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Completed Treatment Cutaneous T-Cell Lymphoma (CTCL) 1 4 Completed Treatment Cutaneous T-Cell Lymphoma (CTCL) / Mycosis Fungoides (MF) / Sezary Syndrome 2 2 Completed Supportive Care Drug/Agent Toxicity by Tissue/Organ / Lymphoma 1 2 Completed Treatment B-Cell Lymphoma 1 2 Completed Treatment B-Cell Lymphoma / Low Grade Lymphoma / Non-Hodgkin's Lymphoma (NHL) / Non-Hodgkin's Lymphomas 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Eisai Inc.
- Hollister-Stier Laboratories LLC
- Ligand Pharmaceuticals Inc.
- Dosage Forms
Form Route Strength Injection, solution Intravenous 150 ug/1mL - Prices
Unit description Cost Unit Ontak 150 mcg/ml vial 878.4USD ml DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.- Patents
- Not Available
Properties
- State
- Liquid
- Experimental Properties
Property Value Source hydrophobicity -0.301 Not Available isoelectric point 5.45 Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Binder
- General Function
- Interleukin-2 receptor activity
- Specific Function
- Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autorea...
- Gene Name
- IL2RA
- Uniprot ID
- P01589
- Uniprot Name
- Interleukin-2 receptor subunit alpha
- Molecular Weight
- 30818.915 Da
References
- Kiyokawa T, Shirono K, Hattori T, Nishimura H, Yamaguchi K, Nichols JC, Strom TB, Murphy JR, Takatsuki K: Cytotoxicity of interleukin 2-toxin toward lymphocytes from patients with adult T-cell leukemia. Cancer Res. 1989 Jul 15;49(14):4042-6. [Article]
- Murphy JR, Kelley VE, Strom TB: Interleukin 2 toxin: a step toward selective immunomodulation. Am J Kidney Dis. 1988 Feb;11(2):159-62. [Article]
- Duvic M, Talpur R: Optimizing denileukin diftitox (Ontak) therapy. Future Oncol. 2008 Aug;4(4):457-69. doi: 10.2217/14796694.4.4.457. [Article]
- Turturro F: Denileukin diftitox: a biotherapeutic paradigm shift in the treatment of lymphoid-derived disorders. Expert Rev Anticancer Ther. 2007 Jan;7(1):11-7. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Agonist
- General Function
- Interleukin-2 receptor activity
- Specific Function
- Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
- Gene Name
- IL2RB
- Uniprot ID
- P14784
- Uniprot Name
- Interleukin-2 receptor subunit beta
- Molecular Weight
- 61116.59 Da
References
- Foss F, Demierre MF, DiVenuti G: A phase-1 trial of bexarotene and denileukin diftitox in patients with relapsed or refractory cutaneous T-cell lymphoma. Blood. 2005 Jul 15;106(2):454-7. Epub 2005 Apr 5. [Article]
- Foss F: Clinical experience with denileukin diftitox (ONTAK). Semin Oncol. 2006 Feb;33(1 Suppl 3):S11-6. [Article]
- Duvic M, Talpur R: Optimizing denileukin diftitox (Ontak) therapy. Future Oncol. 2008 Aug;4(4):457-69. doi: 10.2217/14796694.4.4.457. [Article]
- Turturro F: Denileukin diftitox: a biotherapeutic paradigm shift in the treatment of lymphoid-derived disorders. Expert Rev Anticancer Ther. 2007 Jan;7(1):11-7. [Article]
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Unknown
- General Function
- Interleukin-2 binding
- Specific Function
- Common subunit for the receptors for a variety of interleukins.
- Gene Name
- IL2RG
- Uniprot ID
- P31785
- Uniprot Name
- Cytokine receptor common subunit gamma
- Molecular Weight
- 42286.68 Da
References
- Foss F, Demierre MF, DiVenuti G: A phase-1 trial of bexarotene and denileukin diftitox in patients with relapsed or refractory cutaneous T-cell lymphoma. Blood. 2005 Jul 15;106(2):454-7. Epub 2005 Apr 5. [Article]
- Foss F: Clinical experience with denileukin diftitox (ONTAK). Semin Oncol. 2006 Feb;33(1 Suppl 3):S11-6. [Article]
- Foss FM: DAB(389)IL-2 (denileukin diftitox, ONTAK): a new fusion protein technology. Clin Lymphoma. 2000 Nov;1 Suppl 1:S27-31. [Article]
Drug created at June 13, 2005 13:24 / Updated at January 02, 2024 23:41